KEGG   Methanococcus maripaludis C5: MmarC5_1262Help
Entry
MmarC5_1262       CDS       T00491                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mmq  Methanococcus maripaludis C5
Brite
Enzymes [BR:mmq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MmarC5_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ABO35560
UniProt: A4FZC6
LinkDB All DBs
Position
1207462..1208646
Genome map
AA seq 394 aa AA seqDB search
MDKMYLSEDIPNFEEFIINASKRLNIDEDTLENGFKRKLITKYEYNGKKYLCFKKKLKHI
ERGTILFLNDNLDFIQGYPKIRRAMVLESAVEKYFDNKIAVEEKLDGYNIRIVKFYGEII
AITRGGKICPFTTKKVKKYMNTKFLDDFPELMLCGEMVGLNNPYVSHYYPEADKNHENLG
FYIFDIRNKETNSAISISEKEKLLDKYDIPYVKPIKIIDSSDFEELWNLLDDLNEKHREG
VVLKDLKMIKNPIKYTTHNTQCGDLSVAFKYVYDLGIDFMFSRLVREGYQSFEKCENEEE
IKKRSHDLGESILTPMVETIKEISKDGLAKECFELYFDSEDDFNEFINYLKTMHINFAIE
TREYIKKDVFKAKICRIYNSTSNKIKSHLEGNLW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatgtatctttcagaagatattcctaattttgaagaatttattataaatgcg
tccaaaagattgaatattgatgaagataccctggaaaatggatttaagagaaaattaatt
accaaatatgaatataacgggaaaaaatacctctgttttaaaaagaaattaaaacatatt
gaaagagggactattctttttttaaatgataatttagattttatccaaggttatcccaaa
ataaggcgtgcaatggttcttgaatcagctgttgaaaaatattttgacaacaaaattgca
gtagaagaaaaattagatggctacaatattagaatcgtcaaattttacggagaaattatt
gcaattactcgcggtggaaaaatctgccctttcacaaccaaaaaagtgaaaaaatatatg
aatactaaatttttagacgattttccagaattaatgctctgcggtgaaatggttggattg
aataacccttatgtaagccactactaccctgaagcggataaaaatcatgaaaacctcggg
ttttacatctttgatataagaaataaggaaacaaattctgctatttcgatatctgaaaag
gaaaaacttttagataaatatgatattccatacgtaaaaccgataaaaatcatcgatagt
tctgattttgaagaattatggaatcttttagacgatttaaatgaaaaacatcgagaaggc
gttgttttaaaagatttgaaaatgataaaaaacccgataaagtatactacccacaacacg
caatgcggggacctttcggttgcatttaaatacgtttacgatcttggaattgattttatg
tttagcagacttgtaagagagggctaccaatcatttgaaaaatgtgaaaacgaagaagaa
ataaaaaaacgttcgcatgacctcggggaatcgattttaacaccaatggttgaaactata
aaagaaatttcaaaagatggccttgcaaaagaatgctttgagctttattttgattctgaa
gatgattttaacgaattcataaactaccttaaaacaatgcacataaattttgcaattgaa
accagagaatatatcaaaaaagacgtatttaaggctaaaatttgtagaatctacaattca
acatcaaataagattaaaagccatcttgaaggcaatttatggtaa

DBGET integrated database retrieval system