KEGG   Methanococcus maripaludis C5: MmarC5_1443Help
Entry
MmarC5_1443       CDS       T00491                                 

Definition
(GenBank) cyclic phosphodiesterase MptB
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00790  Folate biosynthesis
mmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MmarC5_1443
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     MmarC5_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: ABO35741
UniProt: A4FZV7
LinkDB All DBs
Position
1377245..1377931
Genome map
AA seq 228 aa AA seqDB search
MNDLIALAEDIKNEKLKKKVVEFINDPIPKHPEIESTGITLETSPASVKRHHKYSGGLIE
HTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSNFHLD
HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHSDNVDAAINDIGIRIC
QARAREFGIDDSQIYKIVNPLKLYEMRKKLGKDKVKEFLKEKLEIKDE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatctgatcgctcttgcagaggatattaagaacgaaaaattaaaaaaaaaggtt
gtcgaatttataaacgatccgattccaaaacatcctgaaattgaaagtactggcataaca
cttgaaacctcccccgcaagcgttaaaagacatcacaaatactccggaggattaatcgaa
catacgatcgcagttacaaaaatggctgtaaaaatggctgaagccttggaagaaacatat
ggaattgaattaaatagagatttgctaatttccggaggaatactccacgatcttatgaaa
ccacaaaattatcagttaaaagacggaaaattcgaccatctttcaaattttcacctcgac
catttgacacttggaattgcagaactgtacagaagggactttccacttgaagttataaaa
gttgtagctagccatcacggagatcatggtcctgtaagtccagattcaatagaagcgtgg
ctaattcatcattcagacaatgtagacgctgcaattaatgatataggaattagaatatgt
caggcgagagctagagaatttggaattgatgattcacaaatatataaaatcgtcaatcca
ttaaaattatatgaaatgcgtaaaaaattgggaaaagataaagtgaaagaatttttaaag
gaaaaattggaaataaaggatgaataa

DBGET integrated database retrieval system