KEGG   Maricaulis maris: Mmar10_1467Help
Entry
Mmar10_1467       CDS       T00394                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmr  Maricaulis maris
Brite
KEGG Orthology (KO) [BR:mmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmr01002]
    Mmar10_1467
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmr04147]
    Mmar10_1467
   04090 CD molecules [BR:mmr04090]
    Mmar10_1467
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Mmar10_1467
Peptidases [BR:mmr01002]
 Metallo Peptidases
  Family M2
   Mmar10_1467
Exosome [BR:mmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmar10_1467
CD molecules [BR:mmr04090]
 Proteins
  Mmar10_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ABI65759
UniProt: Q0APM8
LinkDB All DBs
Position
1607888..1609741
Genome map
AA seq 617 aa AA seqDB search
MKRLMTGVASGALLAVLAGCSAPNEPAADTQAAAPATASPVTVADAEQFLADATTELREF
SEFGARTAWVQNNFITYDTNWLLERMSTQGTEMAVRLATETARFNELEMTTEMSRQMNVL
RAGITLPAPSDSAAAARLSELTTRMGSAYSTGLMEIDGEMVDHNELENIMRTSRDPEFLS
HVWAGWRDSYNPEQMSTDYAEMVEIANAGARDLGFSDLAEMWLSNYDMPADEMEAEVERL
WGQVEPLYEQLHCAVRSELNGLYGDEVQAAEGPIRADLLGNMWAQSWAALADVASVSDAG
PAYDLTQLLVDADYDQIRMVETAETFFTSLGMEELPDTFWERSLITQPRDRQVACHASAW
NLDSVDDLRIKMCTRVNADDFVTVHHELGHNFYQRAYNQQDFLFQGGAHDGFHEAIGDFI
ALSVTPDYLVQIGLLDQADVPDASADLGLLMDTALDKIAFLPFAVMMDQWRWRVLRGEIQ
PDSYNDAWWELRESYQGIVPPVERGETAFDPGSKYHIANNVPYLRYFLSFIMQFQFHEAA
CEMAGWEGPLHRCSIYGNEEVGARFSAMMEMGASQPWPDALEAFTGTREMDGSAIIAYFQ
PLMTHLEEQNATRDCGW
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttgatgaccggggtcgcctccggcgcccttctggcagtacttgcgggctgt
agcgcccccaatgagcctgctgccgacacgcaagctgctgcacctgcaaccgcctcaccc
gtcacggtggccgatgccgaacaattcctcgccgatgcgacgacggaattgcgtgagttc
agcgagttcggcgcccgcaccgcctgggtccagaacaatttcatcacttatgacaccaac
tggctgctcgagcgcatgtcgactcaaggcaccgagatggctgtccgtctggcgaccgag
accgcgcgcttcaatgagctggagatgaccaccgaaatgtcgcggcagatgaatgtgctg
cgcgccgggatcacactgccggcgccgtcagacagtgccgcggcggcacgcctgtccgag
ctgacgacccggatgggctcggcctattcgaccggtctgatggaaatcgacggcgagatg
gtcgaccataacgagctggaaaacatcatgcggaccagccgcgacccggaattcctgtcc
catgtctgggctggctggcgtgacagctacaatcccgagcagatgtcgaccgactatgcc
gaaatggtcgagatcgccaatgccggcgcccgcgatctgggtttctccgatctcgccgag
atgtggctgtccaattacgacatgccggccgacgagatggaggccgaagtcgagcgcctc
tggggccaggtcgagccgctttatgagcagctccattgtgccgtccgctcggagctgaat
ggcctctatggcgacgaggtccaggctgccgagggtccgatccgggccgatctgctgggt
aatatgtgggcccagtcctgggcggccctggccgatgtggcctcggtcagcgatgccggc
cctgcctatgacctgacccagctgctggttgatgccgattacgaccagatccgcatggtc
gaaaccgccgagaccttcttcacctccctgggcatggaagagctgccagacaccttctgg
gagcgttccctcatcacccagccgcgtgaccgccaggtcgcctgccacgcctcggcctgg
aatctcgacagcgtcgatgacctgcgcatcaagatgtgtacccgcgtcaatgccgatgac
ttcgtcaccgtgcaccacgagctgggccacaacttctaccagcgcgcttacaaccagcag
gacttcctgttccagggcggagcgcatgacggtttccacgaagccatcggcgactttatc
gccctgtcggtgacgccagattatctggtccagatcggcttgctcgaccaggcggacgtg
ccggatgcttcggccgaccttggcctgctgatggatacggcgctcgacaagatcgccttc
ctgcccttcgccgtgatgatggatcagtggcgctggcgggtgctgcgtggcgaaatccag
ccggacagttacaatgacgcctggtgggagttgcgcgaaagctatcagggcatcgtgccg
ccggtcgaacgtggcgagacggccttcgatccgggctcgaaataccacatcgccaacaat
gtgccctatctgcgctacttcctgagcttcatcatgcagttccagttccacgaggccgct
tgcgagatggctggctgggaaggtccgctgcaccgttgctcgatctacggcaatgaggaa
gttggcgcccgcttcagcgcgatgatggaaatgggggcctcacagccctggccggacgcg
ctggaagcctttaccggcacccgcgaaatggatggatcggccatcatcgcctatttccag
ccgctgatgacgcatctggaagaacagaacgccacccgcgattgcggctggtag

DBGET integrated database retrieval system