KEGG   Janthinobacterium sp. Marseille: mma_1690Help
Entry
mma_1690          CDS       T00561                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mms  Janthinobacterium sp. Marseille
Brite
Enzymes [BR:mms01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     mma_1690 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: ABR90179
UniProt: A6SYN3
LinkDB All DBs
Position
1910314..1910835
Genome map
AA seq 173 aa AA seqDB search
MKTLPVLSLLATAALAAGCASYGSGPTAEAVMQPTQGNTTNGTVTFSQSGDKVKVAARIT
GLSAGLHGFHIHEKGDCSAPDGMSTGGHFNPDGKKHGAPGHNEHHAGDFGNLSPDSNGTA
VLTLTTSQISLDPNASNSIIGKGLIVHADPDDFTTQPTGNSGKRLSCGVIRLK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccttccagtcctttccctattggctaccgcagcactcgccgccggctgtgcc
agctatggctccggcccgacggcagaagccgtgatgcagccaacacagggcaataccacc
aatggtacggtcaccttctcgcaaagcggcgacaaggttaaagtcgcggcgcgcatcacc
ggcctgtcggcaggcttgcatggtttccatattcatgaaaaaggtgattgcagcgcaccg
gatggcatgagtaccggcggtcacttcaatccggatggcaaaaaacatggcgcccccggc
cacaacgaacatcatgccggtgacttcggcaacctgtcgcccgactccaacggtactgcg
gtactgaccctcaccaccagccagatcagccttgatccgaatgccagcaacagcatcatc
ggcaaaggcttgatcgtgcacgctgatccggatgacttcacgacgcaaccaaccggtaat
tcgggcaagcgcctgtcttgcggtgtcatccgtcttaaatag

DBGET integrated database retrieval system