KEGG   Janthinobacterium sp. Marseille: mma_3013Help
Entry
mma_3013          CDS       T00561                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00473  D-Alanine metabolism
mms00550  Peptidoglycan biosynthesis
mms01100  Metabolic pathways
mms01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mms00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    mma_3013 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    mma_3013 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    mma_3013 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mms01011]
    mma_3013 (ddlA)
Enzymes [BR:mms01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     mma_3013 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mms01011]
 Precursor biosynthesis
  Amino acid ligase
   mma_3013 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp ATPgrasp_ST GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ABR89041
UniProt: A6T2F6
LinkDB All DBs
Position
complement(3376301..3377263)
Genome map
AA seq 320 aa AA seqDB search
MKKEFGKVGVLFGGRSAEREVSLMSGKGVLAALLSKGIDAHPFDPAERSLAELAAEKFDR
VFIALHGRFGEDGSLQGALEQLGIPYTGPGVMASAIAMDKVITKRVCLSHGVPTPKFTAL
EVEATTAEQLQAIAAEFGMPLMLKAPHEGSTIGIAKVETAEGMQAGFDLCAKYDDVVLVE
QFVKGRELTVPVLGSGRNARALPIVEIIAPQGNYDYEHKYFSDDTQYLCPAPFDAAFTKR
VQALAVSAFNAVGCTGWARVDFLVRESDNEPFLLEINTSPGMTGHSLVPMSAKVAGTAYE
DLCVEILRMAKLGLKPVQHK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggaatttggcaaggtcggcgtactgttcggcggtcgctctgccgagcgtgaa
gtatcgctgatgtcgggcaagggtgtattggcagccttgctgtcgaaagggatagacgcg
catccgtttgatccggctgagcgtagcctggcggaattggcagcagaaaaatttgatcgc
gtctttatcgccttgcatggccgctttggcgaagacggcagcctgcagggcgcgctggag
caactcggtattccgtacaccgggccaggtgtgatggcgtcggcaattgcgatggataaa
gtcatcaccaagcgtgtgtgcctgagccatggcgtgcctacgccaaagttcaccgcgctc
gaagtggaagcaactactgcagagcaattgcaggcgatcgcggcggaattcggtatgccg
ctgatgttgaaggccccgcatgaaggttcgaccataggcatcgccaaggttgaaacagcg
gaaggcatgcaagccggttttgatttgtgcgccaaatacgatgatgtggtgctggttgag
cagttcgtcaaaggacgtgagttgaccgtgccggtgctgggcagtggtcgcaatgctcgc
gcgctgccgatagtggaaatcatcgcgccgcagggtaactacgattacgagcacaagtat
tttagtgatgacacccagtacctgtgcccggcaccgtttgatgcagcgtttaccaaacgg
gtgcaggcattggcagtcagtgcattcaatgcggtgggttgcacaggttgggcacgggtt
gatttcctggtgcgtgaatcggataacgaaccgttcctgctggagattaatacttcgccg
ggtatgaccggtcactcgctggtgccgatgtcggccaaggtggcaggtactgcttatgaa
gatttgtgcgtggaaattttacgcatggccaagctgggcctgaaaccagtgcaacacaag
taa

DBGET integrated database retrieval system