KEGG   Methylomonas methanica: Metme_0742Help
Entry
Metme_0742        CDS       T01511                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
mmt  Methylomonas methanica
Pathway
mmt00030  Pentose phosphate pathway
mmt00680  Methane metabolism
mmt01100  Metabolic pathways
mmt01120  Microbial metabolism in diverse environments
mmt01200  Carbon metabolism
mmt01230  Biosynthesis of amino acids
Module
mmt_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Metme_0742
  09102 Energy metabolism
   00680 Methane metabolism
    Metme_0742
Enzymes [BR:mmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Metme_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim QRPTase_C IGPS PcrB TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AEF99183
UniProt: G0A520
LinkDB All DBs
Position
794271..794918
Genome map
AA seq 215 aa AA seqDB search
MARPLIQMALDSLDFDQTVALADQVAPYVDIFEIGTPCIKYNGVNLVKELRNRYPDKLLL
VDLKTMDAGEYEAGAFYAAGADICTVLGVSGLATIAGVIKAAKKHAAETQIDLINVADKA
ECARESVKLGAQIMGIHTGLDAQAAGQTPFADLNEIAGLGLGVRISVAGGIKQATVQQVV
EAGANIIVVGAAIYGAPSPAESAREIRELVDAAAA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaccattaattcaaatggcgttagactcactggatttcgaccaaaccgtagca
ttggccgatcaagtagcgccttatgttgatatttttgaaatcggtaccccttgcatcaaa
tacaacggtgttaatctggtaaaagaactgagaaatcgttatcctgacaaattgctgttg
gttgacctgaaaaccatggatgccggcgaatacgaagcaggtgctttctacgcggcgggc
gcggatatctgcaccgtgttgggcgtatcgggcctggctaccatcgcgggcgttatcaaa
gcggctaaaaaacatgctgctgaaacccaaatcgacctgatcaacgtggcagataaagcg
gaatgcgccagagagtctgttaaattgggtgcacaaatcatgggcattcacaccggtctg
gatgcgcaagcagcaggtcaaacaccttttgccgacctgaatgaaatcgctggtttgggc
ctgggtgtacgtatttccgtcgccggcggtatcaaacaagccactgtgcaacaagtcgta
gaagccggtgcaaacatcatcgttgtcggtgcggctatttatggcgcgccttctccagca
gaatccgctcgtgaaattcgcgaattggtagacgccgcagccgcttaa

DBGET integrated database retrieval system