KEGG   Methylomonas methanica: Metme_0747Help
Entry
Metme_0747        CDS       T01511                                 

Definition
(GenBank) hypothetical protein
Organism
mmt  Methylomonas methanica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEF99188
UniProt: G0A525
LinkDB All DBs
Position
complement(799517..799927)
Genome map
AA seq 136 aa AA seqDB search
MRIIKILATLYAVSFSGIGMAQSTGGHGGHGGGNGGGGADCIKAKISRYTPEHLATVAPG
SEFSFAASGSNGPGHIHVSIKQQPIAVTIQDKDTFYQVKGKLPKEIKNSVVRISVSLKSK
VSRCDAEGGWLLKVSE
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcggattatcaagattttagcgacactatacgccgtgagctttagcggcatcggcatg
gcacagtcaacgggcggccatggtggccacggcggaggaaacggtggtggaggcgctgac
tgtattaaagccaaaataagccgatacacacccgagcatttagctactgtagcgccgggt
tctgagttctcatttgcggcctcgggcagtaacggccccggccacattcacgtcagtata
aagcaacagcccatcgcggtaactattcaggataaggatacgttttatcaggtgaaaggc
aaattaccaaaggagattaaaaattcagtggttcgcatttccgtatcactcaaatccaaa
gtcagcagatgcgatgcagaaggtggttggctattaaaagtatctgaatga

DBGET integrated database retrieval system