KEGG   Methylomonas methanica: Metme_0774Help
Entry
Metme_0774        CDS       T01511                                 

Definition
(GenBank) putative transposase
Organism
mmt  Methylomonas methanica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_Tnp_ISL3 Med30 HTH_23 HTH_7
Motif
Other DBs
NCBI-ProteinID: AEF99213
UniProt: F9ZV92
LinkDB All DBs
Position
complement(827771..828271)
Genome map
AA seq 166 aa AA seqDB search
MITPKKQYSDEFREQALAKVYKRGKRTIQDIADESNLSIHTLKNWMKSSTPTDTSSPNVS
KRPQDWRPEERLLALHESHGISGEALNAWCRQRGLFAHQLAQWKSDFCAVTSARSGGNDS
QTLRTLKAENQRLERELNRKDKALAEAAALLILQKKVRALLAGEVE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgattaccccgaaaaagcagtattctgacgagttcagagagcaagccctggcaaaagtc
tacaaacgtggaaaacgaaccattcaagacattgccgacgaatctaacctcagcatacat
accttaaaaaactggatgaaaagcagcacacccaccgatacgtcaagcccaaacgtgagc
aagcgccctcaagattggcgccccgaagagcgtttactggccctccatgaaagccatggt
atatccggcgaggcattgaatgcctggtgtcggcaacgtggactattcgctcatcaactc
gcgcagtggaaaagcgatttttgtgccgtcaccagcgcccgttcaggcggcaatgacagc
cagacactgcgcactttaaaagccgaaaatcagcgtctggaacgcgaactgaaccgtaag
gacaaagcgctggctgaagccgctgccttgctgatcctgcaaaaaaaggtgcgggcgctg
ttggcgggcgaggtcgaatga

DBGET integrated database retrieval system