KEGG   Methylomonas methanica: Metme_0782Help
Entry
Metme_0782        CDS       T01511                                 

Definition
(GenBank) Protein translocase subunit secA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
mmt  Methylomonas methanica
Pathway
mmt02024  Quorum sensing
mmt03060  Protein export
mmt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Metme_0782
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Metme_0782
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Metme_0782
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmt02044]
    Metme_0782
Enzymes [BR:mmt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Metme_0782
Secretion system [BR:mmt02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Metme_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C ChAPs
Motif
Other DBs
NCBI-ProteinID: AEF99221
UniProt: G0A5U4
LinkDB All DBs
Position
834545..837286
Genome map
AA seq 913 aa AA seqDB search
MLGKLVKLVIGSRNDRLIKKKRKLVKKVNALAADYEKLSDEALQAKTQEFRDRLEQGEKL
DNLIPEAFALVREASTRVFGLRHFDVQLIGGMVLHNGKIAEMKTGEGKTLMATLAAYLNA
LPGKGVHVVTVNDYLARRDAETMGKLYGFLGLTTGVIVSDLDHDQRKAAYAADITYGTNN
EFGFDYLRDNMAFSLEQKVQRELFFGIVDEVDSILIDEARTPLIISGQADGSTDIYLRTN
QVIPHLTRQEKSDDPEKQDQMPGDYFVDEKSRQVHLTEAGYEKVEHLLVEHGLIEEGSTL
YDPANIRLMHYLNASLRGHVLFQKDVDYVVRNDQIIIVDEFTGRMMTGRRWSEGLHQAIE
AKEGVTIQNENQTLASITFQNYFRLYQKLSGMTGTADTEAFELNKIYGLEVVVIPTHRPM
IRKDMGDLVYLSAREKYIAVIEDIKDCHKRGQPVLVGTTSIEKSELISSLLAQQNIPHEV
LNAKQHEREAHIVENAGMPGAVTIATNMAGRGTDIVLGGNLSAELAALGEEAGEAEKEKV
RGAWLDRHEKVIAAGGLHVIGSERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDDLMRI
FASERVAGLMQKLGMQEGEAIEHPWVTRSIESAQRKVEGRNFDIRKEILAYDDVANDQRK
VVYAQRNELMAAEDISDIISAIRSDVINDAITQFIPPKTMEEQWDIAGLEAYVQQDLNMP
LPIAQMLDADLNLNEPKLRQLIVEKAEQESEAKAASIGQDIIRHFEKSVMLQVLDNSWKE
HLAAMDQLRQGIHLRGYGQKDPKQEYKREAFEMFNNLLSHIKVEVVTILAKVQVTKEEDV
QAIDEQRQAPMEMHYEHAEAHSAFEPEPEQLPSAAEPEVTEQPFVRESQKVGRNDPCPCG
SGKKYKHCHGKLS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtaagctggttaaattggtaattggtagccgtaacgacaggctgatcaagaaa
aaacgcaagctggtcaaaaaagtcaatgccttggctgctgattatgaaaaattgtccgat
gaggccttacaagctaaaacacaagagtttcgcgaccgtctggagcaaggcgaaaaactc
gacaatctgataccagaagcctttgcgctggtgcgcgaagcctctacccgtgtgttcggc
ttacgccactttgacgtgcagttgatcggcggcatggtactgcataacggcaaaatcgcc
gaaatgaagaccggtgagggtaaaaccctgatggcgacactggcggcttacctgaatgcg
ctgcccggcaaaggcgtgcacgtggtcaccgtcaacgattatctggcccgccgcgacgcg
gaaaccatgggtaagctctacggctttttgggcttgaccaccggcgtgatcgtcagcgat
ctggatcacgaccaacgtaaagccgcctatgcagccgacatcacctacggcactaataac
gaattcggtttcgactatttgcgcgacaacatggcgttcagcctggagcaaaaggtacag
cgcgaactgtttttcggtatcgttgacgaggtggactcgattctgatcgacgaagccaga
acgccgctgatcatttccggccaagccgacggcagtaccgacatctatctaagaaccaat
caggtgattccgcatctgacccgccaggaaaagtccgacgatccggaaaaacaggatcaa
atgccgggcgattatttcgttgacgaaaaatcccgccaagtgcatttaaccgaggccggt
tacgagaaagtcgagcatttgctggtcgagcatggcttaatcgaggaaggttccacgttg
tacgatccggccaacattcgtttgatgcattatctgaatgcctcgttacgcggccatgtg
ttgttccaaaaagatgtcgattacgtggtcagaaacgaccaaatcatcatcgttgacgaa
ttcaccggccggatgatgaccggacggcgttggtccgagggcttgcatcaggccatcgaa
gccaaagaaggcgtgaccattcaaaacgagaaccagacgctggcctccatcaccttccag
aattatttccgtttataccaaaagctgtcgggtatgaccggtaccgccgataccgaagcg
ttcgagctgaacaaaatttacggtctggaagtggtggtgattcctactcataggcctatg
atccgtaaagatatgggcgatttggtctacctgtctgcgcgggaaaaatatatcgccgtc
atcgaagatatcaaggactgtcacaagcgtggtcaaccggtattggtcggtaccacctcg
atcgaaaaatcggaattaatttccagtttattggcacagcaaaacattccgcatgaagta
ttgaatgccaaacagcatgagcgcgaagcgcatatcgtagaaaacgccggtatgccgggt
gcggtgaccatcgccaccaatatggccggtcgcggtaccgatatcgtgttgggtggtaat
ttgagcgccgagttggctgctttgggtgaagaagccggcgaagccgagaaagaaaaagta
cgcggtgcctggctggatagacacgaaaaagtcatcgcggctggcggtttgcatgtgatc
ggctccgagcggcacgaatcgcgccggatcgataatcagttgcgcggccgttccggtcgt
cagggcgacccgggttcctcgcggttttatctgtccttggaagacgatttgatgcggatt
ttcgcttccgagcgggtggccggtttgatgcaaaaactgggtatgcaggaaggcgaagcc
atcgaacatccgtgggtcacgcgctccatcgaaagcgcccaacgtaaggttgagggtcgc
aacttcgacattcgtaaggaaattctggcctatgacgacgtcgccaacgatcagcgtaaa
gtggtgtatgcgcaacgtaacgaattgatggctgcggaagatatttcagacatcatctcc
gccatccgctccgatgtgattaacgacgccattacccagttcattccgccgaaaaccatg
gaagagcagtgggacattgccggactggaagcgtacgtgcagcaagacttgaacatgccg
ttgcctatcgcgcagatgctggatgccgacctcaatttaaacgagcctaaattgcgtcag
ctgatcgtcgaaaaagccgagcaagaaagcgaagccaaagctgcttcaatcggacaggac
atcatcagacatttcgaaaagtccgtgatgctgcaagtgctggacaacagttggaaagaa
catctggcggccatggatcaattacgtcaaggcatccatttgcgcggctacggtcaaaaa
gatcccaagcaggaatacaagcgcgaagcgtttgaaatgttcaataacttgctgagccat
attaaagtggaagttgtgacgattctggctaaagtccaagttaccaaggaagaagacgtg
caggctattgacgaacaacgtcaggcgcctatggaaatgcattacgaacatgccgaagcg
cattccgccttcgaaccggagccggaacaactgccgtcggcagcggaaccggaagtcaca
gagcaaccgtttgtcagggaatcgcaaaaggttggccgcaacgatccctgtccatgtggt
tcaggcaaaaaatataaacattgccacggtaaattgagctaa

DBGET integrated database retrieval system