KEGG   Methylomonas methanica: Metme_0790Help
Entry
Metme_0790        CDS       T01511                                 

Definition
(GenBank) NAD(P)H quinone oxidoreductase, PIG3 family
Organism
mmt  Methylomonas methanica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N ADH_N_2 EIIA-man
Motif
Other DBs
NCBI-ProteinID: AEF99229
UniProt: G0A5V2
LinkDB All DBs
Position
complement(844184..845161)
Genome map
AA seq 325 aa AA seqDB search
MRAIEIVPNANGNALKLCELPMPVPNDFQVLIEVKAAGVNRPDIMQRQGVYPPPAGASPI
LGLEVAGIVVETGAKATTFKPGDAVCALLTGGGYAEYCLASEACCLPMTSGFTFTEAAAL
PETFFTVWSNVFERGRLAFGESLLVHGGGSGIGTTAIQLAKAFDHSIYITAGSDEKCQRC
LDLGADAAINYRQQDFVEIIHQLTRNHGVDVILDMIGGDYLPRNLKCLAVEGRLVQIAIQ
NGPKSEINLWQLMLKRQTITGSTLRGREDSFKGNIALQLRKNVWPLLEAGKLKPSLDSVF
PLADAEQAHTRMTGNQHFGKIVLEI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgattgaaattgtcccaaacgccaacggaaacgcattaaaactatgcgaactc
ccgatgccggttccaaacgattttcaggtcttaatcgaggtcaaagccgcgggcgttaac
cggccggatatcatgcagcgtcaaggcgtatatccgccgcctgccggcgcctcgccgata
ttgggactagaagtggccggcatcgtcgtggaaaccggcgctaaagccactacttttaaa
cccggagatgcggtttgcgcgctgcttaccggtggcggctacgccgagtattgcttggcc
agtgaagcatgctgcctgcctatgacaagcgggttcacctttaccgaggccgccgcccta
cctgaaactttttttaccgtctggagcaatgtcttcgagcgcggccggctagccttcggc
gaaagcctgctggtgcatggcggcggtagcggcatcggcactaccgctatccagctagcc
aaggctttcgaccattccatttacatcacagcgggcagcgatgagaaatgccagcgctgt
ctcgatctgggtgcagacgccgccatcaattaccggcaacaggattttgtcgaaatcatc
catcaattgacccgcaaccacggcgtcgacgtcattctggatatgataggcggtgactac
ctgccgcgtaacctaaaatgtctggccgttgaaggccgcttggtacaaattgccatccaa
aacggccccaaaagcgaaatcaacttgtggcaactcatgctcaagcgccaaaccatcacc
ggctccacactgcgcggccgcgaggacagcttcaaaggtaacattgctttacaattacgc
aaaaacgtctggccgctactggaggccggcaagcttaaacccagcctggattccgtgttt
ccgctggcggacgccgaacaagcgcatacacggatgaccggcaaccaacatttcgggaaa
atcgttttggagatttaa

DBGET integrated database retrieval system