KEGG   Methylomonas methanica: Metme_3258Help
Entry
Metme_3258        CDS       T01511                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmt  Methylomonas methanica
Pathway
mmt00620  Pyruvate metabolism
mmt00680  Methane metabolism
mmt01100  Metabolic pathways
mmt01120  Microbial metabolism in diverse environments
mmt01200  Carbon metabolism
Module
mmt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Metme_3258
  Energy metabolism
   00680 Methane metabolism
    Metme_3258
Enzymes [BR:mmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Metme_3258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEG01630
UniProt: G0A5C4
LinkDB All DBs
Position
3590193..3592994
Genome map
AA seq 933 aa AA seqDB search
MSRTPEYDDKTLRANIRLLKGMLDNVLKNQASHQVAEIVEQLQRQFTVLQRDNNPAKRQQ
ILKTLHNLPAETLSEVIRAFSLYFSLLNIAEESTQLQHRRHQIEKNKHYWRGSFHDTLLA
FKNAGISAEQLQPLLDDLHYLPVMTAHPTEAKRRTVRGALRSVFVSHEKLQNSGIKGYFR
DVALERLQSQIQLLWKTDEVRAHSMGVIDEIDSGLFYFPLSLFEATAQVYRNFQRALVDV
YGSDAASKVNIPSFLNFGSWIGGDRDGNPNVKPHTTALALRLQARTITREYLRRIDILLE
QLAYSHGMCQPTEAFLQSLQNDRDLLGDTAITLERNYLQEPYRHKLALMKFRMHRRMELL
EQRIAGDSSQSDDQAYNNIQTFHADLCLIRESLSSHGDQAIADRDLQDLIRLVDIFGFYL
MQLDVRQESTRHSQAVAEILSAGLGIDYLSMDEDQRMQVLSEAIAIPGGLGYDASELSAA
TVETLDVFQVMAQMRREIGNDCFSRYVISMTHSASHIMEVLLLAAQNGLAGRISGQWYCH
IGVSPLFETIDDLNHIDGVLRSLLSQPAYRALLEASGLRQEVMLGYSDSCKDGGILASAW
GLYRAQQQVTAISDDVGIPCRLFHGRGGTIGRGGGPTHEAILAQPPATVRGQIKFTEQGE
VLFYRYNNMETAIYELTMGITGLMKASVSLIQPVEPDRPDNLQLMGELAQLGERSYRQLT
EHTPGFLDYFYEATPVQEIGQLNIGSRPSHRKKADRSKYSVRAIAWVFAWAQSRQTFPAW
YGIGSSLESYCAGNPERLQALRELYKNWPFFRNLLSNAQMALSKSDMTIAEEYSSLCSDP
EAGKRVHGLIAGEHRRCVDWVLEIAECDQLLAENPELAASLRRRNDYLGPLNYMQAGLLR
ALNEDEDANGQSRWMNPLLRTINAIAAGMRNTG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtacacccgaatacgacgataaaaccctgcgtgccaacatccgtttactaaaa
ggcatgctggataatgtgttgaaaaaccaagccagccatcaagtggcggagattgtcgag
cagttacagcgccaatttaccgtgctgcagcgggataacaatcccgccaaacgccagcag
atactcaaaaccctgcacaatttgccggcggaaaccttaagcgaagtaatccgcgcattc
agcttatacttcagcttgctgaatatcgccgaagaatccactcaattgcagcaccgccgc
catcaaatcgaaaaaaacaagcactattggcgcggctcgtttcacgacaccctgctggcc
ttcaaaaacgccggcatcagtgccgaacaactacaaccgctgctggacgacttgcattat
cttccggtcatgaccgcccaccccaccgaagccaagcgccgcaccgtacgcggcgccttg
cgtagcgtgttcgtcagtcacgaaaaactgcaaaatagcggaatcaagggctattttcgc
gatgtagcgctggagcgcctgcaaagccagattcagttattgtggaaaaccgacgaagtg
cgtgctcacagcatgggcgtgatcgatgaaatcgactctgggctgttttattttccgttg
tcgctgttcgaagccactgcccaggtataccgcaattttcagcgcgccttggtcgatgtc
tacggcagcgatgccgcatcgaaggttaatattcccagttttttaaatttcggttcgtgg
ataggcggcgaccgcgacggcaaccccaacgtcaaaccgcacaccaccgccctggcttta
cgcctgcaggcccgcaccatcacccgggaatatctgcgccgcatcgacatcctgctcgaa
caattggcctactcccacggtatgtgccaaccgactgaagcatttttgcaaagcctgcaa
aacgaccgggacttgctgggcgacacggctataaccctggaacgcaactacttgcaagaa
ccgtatcggcataaactggcgttgatgaaattccgcatgcaccggcgcatggagttgctc
gagcagcgcatcgccggggacagttcgcagtccgacgatcaggcctacaacaacatccag
acgtttcacgccgatttatgcctgattcgcgagtctttgagcagccatggcgaccaagcc
atcgcggatcgcgacttgcaggatttgatccgcctggtggacattttcggtttttatttg
atgcagttggacgtgcgccaggaatccacccgacatagccaagccgtcgcggaaattctt
tccgccggtttgggtatcgattacttaagcatggacgaagaccaacgcatgcaagtgctg
agcgaagccattgccattccgggcggactgggttacgacgccagcgagctcagcgcggct
accgtggaaaccctggatgtgtttcaggtgatggcgcaaatgcgccgcgaaatcggcaac
gactgtttcagccgctacgtgatctcgatgacccattcggccagccatatcatggaagtg
ctgctgctggccgcgcaaaacggcttggccggccgtatcagcggccaatggtattgccat
atcggcgtcagccccttattcgaaaccatagacgacctcaaccacatcgacggcgtctta
cgcagtctgctgtcgcaaccggcctaccgcgccttgctggaggcctccggcctgcgtcag
gaagtgatgctgggctattcggactcctgcaaggacggcggcatcttggcgtcggcctgg
ggactgtaccgcgcccagcaacaggtaacggctatttcggatgatgtaggcattccttgc
cgtttgtttcacggccgcggcggcaccatcggccggggcggcggccccacccacgaagcg
attttggcccaaccgccggccaccgtgcgcgggcagatcaagtttaccgaacaaggcgaa
gtgctgttttaccgttacaacaacatggaaaccgccatatacgagttgaccatgggcatt
accggcctgatgaaagccagtgtcagcctgatccagccggttgaaccggaccgccccgac
aatctgcagttgatgggcgaactggcgcaactgggcgaacgcagttaccggcaactgacc
gaacatacccccggctttctggattatttttacgaagccaccccggtacaggaaatcggt
caattgaacatcggctcccggccgtcgcaccgcaaaaaggcggaccgttccaaatactcg
gtgcgggcgattgcctgggtgtttgcctgggcccaatcgcggcaaacctttccggcttgg
tacggcatcggctccagcctggaaagctactgcgccggcaacccggaacgtttgcaggca
ctgcgcgaactatataaaaactggccgtttttccgcaacctgctcagtaacgcgcaaatg
gccctcagcaaatccgatatgaccattgccgaggaatacagtagtctgtgcagcgatccg
gaagcgggcaaacgggtgcacgggctgatcgccggcgaacaccgccgctgtgtcgattgg
gtgctggagatcgccgaatgcgaccaattactggcggaaaatccggaactggctgcctcc
ctgcgtcgccgtaacgactacctgggtccgttaaattacatgcaggccggcttgttgcgc
gcgctcaacgaagacgaggacgccaacggccaaagccgctggatgaaccctttgctgcgc
actatcaatgccatcgcggccggcatgcgtaacacgggctaa

DBGET integrated database retrieval system