KEGG   Methylomonas methanica: Metme_3540
Entry
Metme_3540        CDS       T01511                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
mmt  Methylomonas methanica
Pathway
mmt00620  Pyruvate metabolism
mmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Metme_3540
Enzymes [BR:mmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     Metme_3540
SSDB
Other DBs
NCBI-ProteinID: AEG01906
UniProt: G0A7R3
LinkDB
Position
3930243..3933713
AA seq 1156 aa
MDMLRALGLGSADQDQQGIKQQLHLYINLKLASCGQPICNDAESAAFMDTAQDLLNSYLE
KNRQLAGSSLYPADRRIQNFLDRYLADLNLDKTPTLPTMTFELDRHGVARELSLPLGADE
FKSEIVSSYRVKQGVLHNPASDRRTTEGSFHIAEGGLPVPGDKKQVPKLTFARMLEQALK
PPADMMIVPFTANQPQPARMFASLLLRPVICPEIPGMEAEKSMEIRFFAPGNLVSNLDFV
ESIFGNGGNPALPECDAALDIEHWSGHSGCVILAPHLTKLTKKEVGLPHWDQASERQRAD
GMCWEQEDELYNNGQAFKLCARDTSGVIVTLLADNYYGYCKKEVKTQISYAANLFGSAEE
EHAGGALAFRRFNHGDEFGVGSLTREPGYDFDEMAYHYGAIMTVQPEGYAIDNQFPDVVY
VPQDLRMNLNTQKITWVKNGKSHAIRLQPGKIYIQPNGYKIEMCKHPGAPSWRLVGTVAE
GTFCHKPCTVSGGGKSEISKSIEDAVIYGPLFVDDIQRDLDRVQAIFDKDYTGRFMPGFE
HEDHDPTRAILSDERSLGSVIKLLTPSPHHTADFNAWLKSIPPSIMALVFLIKRFYRSEW
GDNWRDHLSVDIIDGAPGHELKLDHRKIVATYLRVGFDLEGGWRTFKVRQDYLACEKVQM
EDDISASVVVPVAAIRPWLAQDTREHSVKLISNCEYRLFQRPDDAIIPGYDKQTELNMSA
PGNFMANFEPLDHDKLAEVVEDVQTFSKFTPPMHDLLNKAYQQKPSYVVSSAHPRLVNGK
PSKNPRYLETRVDLVKPLRKYVAEIGARLHRKIPLHQPLCHPVDAVLTGRRNNPPDGKIR
ALAVYNPIHYQDLPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALRPTADLNNALVS
FILTGYPGFSSSAGYIGPDIRVDHDISLLIPEIWSRLSKEERQPDYLLKHGYLEPLNDFE
HNGRIVLASRLGYRITSHFVHGLMGKIFDNPYAVFTDEILQPERQNLEVFVDGVNNIVET
QQKVAQQYLDDGSIEDACPPLYALLHIMALGHYQGMDAHHPDIRAMFTREYLLNSAWYQE
RLTIKQQRDAALWQSHVDYLDKLIQDGTHHTQSANDYWQTRRQEAAEKLEKLQAPDYLQA
LIGTLGADPLQPYQAD
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggatatgttacgggcgctgggtctcggatccgccgatcaggaccagcaaggtatcaag
cagcaactgcatctttatatcaatttaaagctggcctcctgcgggcagccgatctgcaac
gatgccgagtccgctgctttcatggataccgcccaggacttgttgaacagctatctggaa
aaaaaccgccagttggccggttcttcgctctaccccgccgatcgccgtatccagaatttc
ctggaccgctatctggccgatttaaacctggataaaacgccgaccttacccaccatgacc
tttgaattggaccggcacggcgtagcccgcgagctgtcgctaccgctgggcgccgatgaa
ttcaaatcggaaatcgtctccagttaccgggtaaagcaaggcgtattgcacaatcccgcc
agcgaccgccgcaccaccgaaggctcgtttcatatcgcggaaggcgggctaccggtaccc
ggcgacaagaagcaagtgccaaaattaacgttcgcccgcatgctggaacaggcacttaag
ccgccggcggacatgatgatagtgccgtttaccgccaaccagccccaaccggcccggatg
ttcgcctcgttgttgttacgcccggtaatttgcccggaaattcccggtatggaagcggaa
aaatccatggaaatccgctttttcgcgcccggtaacttggtcagcaacctggatttcgtg
gaaagtattttcggcaacggcggtaacccggccttgcccgaatgcgatgctgctctggat
atcgaacattggagcggccacagcggctgcgtgattttggcgccgcatttgaccaaactc
accaaaaaggaagtcggcctgccgcattgggaccaggccagcgaacggcagcgcgccgac
ggcatgtgctgggaacaggaagacgaactctacaacaacggtcaggcattcaaactctgc
gcccgagacacctccggcgtgatcgtcacgctgctggccgataattattacggttactgc
aaaaaagaagtcaagacccaaatcagttacgccgccaatttattcggttccgccgaggaa
gaacatgccggcggcgcgctggctttccggcgcttcaaccacggcgacgaattcggggtc
ggcagcctgacccgcgagcccggttacgatttcgacgagatggcttaccactacggcgcc
atcatgaccgtgcaaccggaaggctatgcgatcgacaatcagtttcccgacgtggtttac
gtgccgcaggatttgcggatgaatctgaatacccagaaaatcacctgggtcaagaacggc
aaaagccacgccattcgactgcagccgggcaaaatttatatccaacccaacggctacaaa
atcgaaatgtgcaaacaccccggtgccccttcctggcgcttggtcggcaccgtggcggaa
ggcactttttgccataaaccctgtacggtgtccggcggcggcaaatcggagatttccaaa
tccatcgaagacgccgtgatttacgggccgctgtttgtcgacgatatccagcgcgatctg
gaccgggtacaggccattttcgacaaggattataccggccgcttcatgcccggtttcgaa
catgaagaccacgatcccacccgtgccatcctcagcgacgagcgcagcctgggttccgtg
atcaaattactcacgccgtccccgcaccacactgcggatttcaacgcctggctcaaatcc
atcccgcccagcatcatggccctggtgtttttgatcaaacgcttttaccgcagcgaatgg
ggcgataattggcgcgaccatttatccgtcgacattatcgacggcgcccccggccacgaa
ttgaaactggatcaccgcaagatcgtcgccacttatcttcgcgtgggtttcgatctggaa
ggcggctggcgcacctttaaagtacgccaggactatctggcttgcgaaaaggtacagatg
gaagacgacatcagcgcttcggtggtagtaccggtagcggcaatacgcccgtggctggct
caggatacgcgcgaacatagcgtaaaactgatcagcaactgcgaataccggctgttccaa
cgtcccgatgacgccatcatccccggctacgacaagcaaaccgagctgaatatgtccgcc
cccggcaatttcatggccaatttcgaaccgctggatcacgacaaactggccgaggtggtg
gaagacgtacagaccttttccaagttcaccccgcccatgcatgatttgctgaacaaggcc
taccaacaaaaaccgtcttacgtggtgtcgtcggcgcatccgcgtctggtaaacggcaaa
ccttccaaaaatccgcgctatttggaaacccgggtcgacttggtcaaaccgctgcgcaaa
tacgtggcggaaatcggcgcccgcttgcaccgcaaaatccccttgcatcaaccgctttgc
cacccggtggatgcggtactgaccggccgccgcaacaatccgcccgacggcaaaatcagg
gccttggcggtgtataaccccatccattaccaggacttgccggaattgttcatggacttt
gtctgctcgctgacaggcaaatcgccgtccactaccggcgccggcagcgagggcgccctg
accaaggggccatttaacgccttgcggccaaccgccgacctgaacaatgcactggtgtcg
ttcattctgaccggctaccccggcttttccagctcggccggctatatcggcccggatatt
cgcgtggatcacgatatcagcctactgattccggaaatctggtcgcgcttatccaaagaa
gaacgccagccggattacttgctgaaacacggctacctggaaccgctcaacgacttcgag
cataacggtcgcatcgtgctggccagccgcctgggctaccgtatcaccagccattttgtg
cacggtttgatgggcaaaatcttcgacaatccgtatgcggtgtttaccgacgaaatcctg
caacccgagcggcaaaatctggaggtattcgtcgacggcgtcaacaacatcgtcgaaacc
caacaaaaagtggcccaacaatatctggacgacggcagcatcgaggatgcctgtcctccc
ttgtatgccttgctgcatattatggccttggggcattaccagggcatggacgcgcaccat
ccggacatacgcgccatgttcacccgcgagtatctgttaaattccgcgtggtaccaagaa
cggctaacgatcaaacaacaacgggatgcggcgttgtggcagagtcatgtggactatctg
gacaaactgattcaggacggcacccaccatacccaatccgcaaacgattactggcaaacg
cgccgccaggaagctgcggaaaaactggaaaaactgcaagcgccggactacttgcaagcc
ctgatcggtaccctgggcgcggatccgttgcagccttatcaagcggattag

DBGET integrated database retrieval system