KEGG   Mus musculus (mouse): 100039053Help
Entry
100039053         CDS       T01002                                 

Gene name
Gm2023, Ccl19, Elc, Scya19
Definition
(RefSeq) predicted gene 2023
  KO
K05512  C-C motif chemokine 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100039053 (Gm2023)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100039053 (Gm2023)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100039053 (Gm2023)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100039053 (Gm2023)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100039053 (Gm2023)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100039053 (Gm2023)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100039053
NCBI-ProteinID: XP_001472218
MGI: 3780192
Ensembl: ENSMUSG00000094661
UniProt: O70460 Q548P0
LinkDB All DBs
Position
4 A5; 4
AA seq 108 aa AA seqDB search
MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCR
VPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgtgtgaccccactcctggccttcagcctgctggttctctggaccttccca
gccccaactctggggggtgctaatgatgcggaagactgctgcctgtctgtgacccagcgc
cccatccctgggaacatcgtgaaagccttccgctaccttcttaatgaagatggctgcagg
gtgcctgctgttgtgttcaccacactaaggggctatcagctctgtgcacctccagaccag
ccctgggtggatcgcatcatccgaagactgaagaagtcttctgccaagaacaaaggcaac
agcaccagaaggagccctgtgtcttga

KEGG   Mus musculus (mouse): 100039848Help
Entry
100039848         CDS       T01002                                 

Gene name
Gm2457
Definition
(RefSeq) predicted gene, 2457
  KO
K05512  C-C motif chemokine 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100039848 (Gm2457)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100039848 (Gm2457)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100039848 (Gm2457)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100039848 (Gm2457)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100039848 (Gm2457)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100039848 (Gm2457)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100039848
NCBI-ProteinID: XP_006538477
MGI: 3780624
LinkDB All DBs
Position
4 A5; 4
AA seq 154 aa AA seqDB search
PSCHRRTSERFPSLPCEPVGASASQILAHTVSQAHSLSVACLRSSATAPRVTPLLAFSLL
VLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQL
CAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ccttcatgccacaggaggacatctgagcgattcccgtcactcccctgtgaacccgtcgga
gcctcggcctctcagattcttgcgcacacagtctctcaggctcactcactctctgtggcc
tgcctcagatcgtctgccacggccccccgtgtgaccccactcctggccttcagcctgctg
gttctctggaccttcccagccccaactctggggggtgctaatgatgcggaagactgctgc
ctgtctgtgacccagcgccccatccctgggaacatcgtgaaagccttccgctaccttctt
aatgaagatggctgcagggtgcctgctgttgtgttcaccacactaaggggctatcagctc
tgtgcacctccagaccagccctgggtggatcgcatcatccgaagactgaagaagtcttct
gccaagaacaaaggcaacagcaccagaaggagccctgtgtcttga

KEGG   Mus musculus (mouse): 24047Help
Entry
24047             CDS       T01002                                 

Gene name
Ccl19, CKb11, ELC, MIP3B, Scya19, exodus-3
Definition
(RefSeq) chemokine (C-C motif) ligand 19
  KO
K05512  C-C motif chemokine 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    24047 (Ccl19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24047 (Ccl19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24047 (Ccl19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    24047 (Ccl19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    24047 (Ccl19)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   24047 (Ccl19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 24047
NCBI-ProteinID: NP_036018
MGI: 1346316
Ensembl: ENSMUSG00000071005
Vega: OTTMUSG00000006591
UniProt: O70460 Q548P0
LinkDB All DBs
Position
4; 4 A5
AA seq 108 aa AA seqDB search
MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCR
VPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgtgtgaccccactcctggccttcagcctgctggttctctggaccttccca
gccccaactctggggggtgctaatgatgcggaagactgctgcctgtctgtgacccagcgc
cccatccctgggaacatcgtgaaagccttccgctaccttcttaatgaagatggctgcagg
gtgcctgctgttgtgttcaccacactaaggggctatcagctctgtgcacctccagaccag
ccctgggtggatcgcatcatccgaagactgaagaagtcttctgccaagaacaaaggcaac
agcaccagaaggagccctgtgtcttga

DBGET integrated database retrieval system