KEGG   Mus musculus (mouse): 100041504Help
Entry
100041504         CDS       T01002                                 

Definition
(RefSeq) C-C motif chemokine 21c
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100041504
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100041504
   04061 Viral protein interaction with cytokine and cytokine receptor
    100041504
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100041504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100041504
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100041504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100041504
NCBI-ProteinID: XP_001473308
Ensembl: ENSMUSG00000094121
UniProt: P86792 P86793
LinkDB All DBs
Position
4
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100041593Help
Entry
100041593         CDS       T01002                                 

Definition
(RefSeq) C-C motif chemokine 21c
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100041593
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100041593
   04061 Viral protein interaction with cytokine and cytokine receptor
    100041593
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100041593
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100041593
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100041593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100041593
NCBI-ProteinID: XP_001473444
Ensembl: ENSMUSG00000096271
UniProt: P86792 P86793
LinkDB All DBs
Position
4
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100042493Help
Entry
100042493         CDS       T01002                                 

Gene name
Ccl21b, 6CKBAC1, 6Ckine, AI159701, CKb9, SLC, Scya21, Scya21a, Scya21c, TCA4
Definition
(RefSeq) chemokine (C-C motif) ligand 21B (leucine)
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100042493 (Ccl21b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100042493 (Ccl21b)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100042493 (Ccl21b)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100042493 (Ccl21b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100042493 (Ccl21b)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100042493 (Ccl21b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100042493
NCBI-ProteinID: NP_035465
MGI: 1349182
Ensembl: ENSMUSG00000095675
UniProt: P86792 P86793
LinkDB All DBs
Position
4 A5; 4 22.12 cM
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100504239Help
Entry
100504239         CDS       T01002                                 

Gene name
Gm10591, 6Ckine, Ccl21b, Ccl21c, Scya21, Scya21b, Scya21c, TCA4
Definition
(RefSeq) predicted gene 10591
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100504239 (Gm10591)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100504239 (Gm10591)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100504239 (Gm10591)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100504239 (Gm10591)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100504239 (Gm10591)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100504239 (Gm10591)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100504239
NCBI-ProteinID: NP_001180597
MGI: 3711256
Ensembl: ENSMUSG00000096596
UniProt: P86792 P86793
LinkDB All DBs
Position
4; 4 A5
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100504346Help
Entry
100504346         CDS       T01002                                 

Gene name
Gm13304, 6Ckine, Ccl21b, Ccl21c, Scya21, Scya21b, Scya21c, TCA4
Definition
(RefSeq) predicted gene 13304
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100504346 (Gm13304)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100504346 (Gm13304)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100504346 (Gm13304)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100504346 (Gm13304)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100504346 (Gm13304)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100504346 (Gm13304)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100504346
NCBI-ProteinID: NP_001180595
MGI: 3710514
Ensembl: ENSMUSG00000073878
Vega: OTTMUSG00000011350
UniProt: P86792 P86793
LinkDB All DBs
Position
4; 4 A5
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100504362Help
Entry
100504362         CDS       T01002                                 

Gene name
Gm1987, 100038965
Definition
(RefSeq) predicted gene 1987
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100504362 (Gm1987)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100504362 (Gm1987)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100504362 (Gm1987)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100504362 (Gm1987)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100504362 (Gm1987)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100504362 (Gm1987)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100504362
NCBI-ProteinID: NP_001180596
MGI: 3780156
Ensembl: ENSMUSG00000095320
UniProt: P84444
LinkDB All DBs
Position
4; 4 A5
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggtcaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttctcaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 100862177Help
Entry
100862177         CDS       T01002                                 

Gene name
Gm21541, 6Ckine, Ccl21b, Ccl21c, Scya21, Scya21b, Scya21c, TCA4
Definition
(RefSeq) predicted gene, 21541
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100862177 (Gm21541)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100862177 (Gm21541)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100862177 (Gm21541)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100862177 (Gm21541)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100862177 (Gm21541)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100862177 (Gm21541)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100862177
NCBI-ProteinID: NP_001257289
MGI: 5434896
Ensembl: ENSMUSG00000094065
Vega: OTTMUSG00000011347
UniProt: P86792 P86793
LinkDB All DBs
Position
4 A5; 4
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 18829Help
Entry
18829             CDS       T01002                                 

Gene name
Ccl21a, 6CKBAC2, 6Ckine, ALP, AW987545, CKb9, SCYA21a, SLC, Scya21, Scya21b, Tca4, plt
Definition
(RefSeq) chemokine (C-C motif) ligand 21A (serine)
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    18829 (Ccl21a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18829 (Ccl21a)
   04061 Viral protein interaction with cytokine and cytokine receptor
    18829 (Ccl21a)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    18829 (Ccl21a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18829 (Ccl21a)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   18829 (Ccl21a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 18829
NCBI-ProteinID: NP_035254
MGI: 1349183
Ensembl: ENSMUSG00000094686
Vega: OTTMUSG00000006590
UniProt: P84444
LinkDB All DBs
Position
4 A5; 4 22.81 cM
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggtcaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttctcaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

KEGG   Mus musculus (mouse): 65956Help
Entry
65956             CDS       T01002                                 

Gene name
Ccl21c, 6Ckine, CKb9, Ccl21b, SLC, Scya21, Scya21b, Scya21c, TCA4, exodus-2
Definition
(RefSeq) chemokine (C-C motif) ligand 21C (leucine)
  KO
K16062  C-C motif chemokine 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    65956 (Ccl21c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    65956 (Ccl21c)
   04061 Viral protein interaction with cytokine and cytokine receptor
    65956 (Ccl21c)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    65956 (Ccl21c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    65956 (Ccl21c)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   65956 (Ccl21c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 65956
NCBI-ProteinID: NP_075539
MGI: 1891386
Ensembl: ENSMUSG00000096873
UniProt: P86792 P86793
LinkDB All DBs
Position
4 A5; 4 22.54 cM
AA seq 133 aa AA seqDB search
MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIP
AILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSK
GCKRTEQTQPSRG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatgatgactctgagcctccttagcctggtcctggctctctgcatcccctgg
acccaaggcagtgatggagggggacaggactgctgccttaagtacagccagaagaaaatt
ccctacagtattgtccgaggctataggaagcaagaaccaagtttaggctgtcccatcccg
gcaatcctgttcttaccccggaagcactctaagcctgagctatgtgcaaaccctgaggaa
ggctgggtgcagaacctgatgcgccgcctggaccagcctccagccccagggaaacaaagc
cccggctgcaggaagaaccggggaacctctaagtctggaaagaaaggaaagggctccaag
ggctgcaagagaactgaacagacacagccctcaagaggatag

DBGET integrated database retrieval system