KEGG   Mus musculus (mouse): 100042150
Entry
100042150         CDS       T01002                                 

Gene name
Nrg2, Do, Don1, NT, NTAK
Definition
(RefSeq) neuregulin 2
  KO
K05456  neuregulin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04012  ErbB signaling pathway
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100042150 (Nrg2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100042150 (Nrg2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100042150 (Nrg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100042150 (Nrg2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   100042150 (Nrg2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set Ig_6 C2-set_2 EGF EGF_2
Other DBs
NCBI-GeneID: 100042150
NCBI-ProteinID: NP_001161363
MGI: 1098246
Ensembl: ENSMUSG00000060275
Vega: OTTMUSG00000014928
UniProt: D3YZR2
LinkDB
Position
18 B2; 18 19.38 cM
AA seq 857 aa
MRQVCCSALPPPLEKARCSSYSYSYSDSSSSTTSSSRSSSSSSSRNSSSSNSSSSESSGS
NSGSSSIFRPAAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVS
LACYSPSLKSVQDQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPL
RSGGLQREQVISVGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPVDPNGKNIKKEVGKIL
CTDCATRPKLKKMKSQTGEVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGN
GRKNSRLQFNKVRVEDAGEYVCEAENILGKDTVRGRLHVNSVSTTLSSWSGHARKCNETA
KSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTI
TGICVALLVVGIVCVVAYCKTKKQRRQMHHHLRQNMCPAHQNRSLANGPSHPRLDPEEIQ
MADYISKNVPATDHVIRREAETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESL
TSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYSQEERRRAAMPPYHDSIDSLRDSPHS
ERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLR
HPAPPGPGPGSGPGADMQRSYDSYYYPAAGPGPRRSACALGGSLGSLPASPFRIPEDDEY
ETTQECAPPPPPRPRTRGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGCGS
ASASDDDADDADGALAAESTPFLGLRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRASS
RHSRGPPTRAKQDSGPL
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccactggagaaggctcggtgcagcagc
tacagctacagttacagcgacagcagcagcagcaccaccagcagcagcagaagcagcagc
agcagcagcagcagaaacagcagcagcagcaacagcagcagcagcgagagcagcggcagc
aacagcggcagcagcagcatcttccgtcccgctgcgcccccagagccgcggccgcagcca
cagccgcagccccgcagccccgcagcccggagagccgccgcccgctcgcgagccgcagcc
gccggcggcatgaggcgcgacccggcccccggcttctcgatgctgctcttcggtgtgtca
ctcgcctgctactcgcccagcctcaagtcggtgcaggaccaggcgtacaaggcacccgtg
gtggtggagggcaaggtacagggactggccccggcaggcggttccagctctaacagcacc
cgagagccgcccgcctcgggtcgggtggcgctggtgaaggtgctggacaagtggccgctc
cggagcggggggctgcagcgcgagcaggtgatcagcgtgggctcctgtgcgccgctcgaa
aggaaccagcgctacatctttttcctggagcccaccgagcagcccttagtttttaagaca
gcctttgccccggtcgaccctaacggcaaaaacatcaagaaagaggtgggcaagatcctg
tgcactgactgcgccacccggcccaagctgaagaagatgaagagccagacaggagaggtg
ggtgagaagcagtcgctcaagtgtgaggcagcggcgggaaacccccagccctcctatcgc
tggttcaaggatggcaaggaactcaaccggagtcgtgatattcgcatcaagtatggcaat
ggcagaaagaactcacggctacagttcaacaaagtgagggtggaggatgccggggagtac
gtctgtgaggccgagaacatccttgggaaggacaccgtgaggggccgactccatgtcaac
agcgtgagcaccactctgtcatcctggtcgggacatgcccggaagtgcaatgagaccgcc
aagtcctactgtgtgaatggaggcgtgtgctactacatcgagggcatcaaccagctctcc
tgcaaatgtccaaacggattcttcggacagagatgtttggagaaactgcctttgcgattg
tacatgccagatcctaagcaaaaggctgaggagctgtaccagaagagagtgctgacaatt
actggtatctgtgtggccctgctggtcgtgggcatcgtctgtgtggtcgcctactgcaag
accaaaaaacagaggaggcagatgcatcatcatctccggcagaacatgtgcccagcccac
cagaaccgaagcctggccaacgggcccagccaccctcggctggaccctgaggagatccag
atggcagattacatctccaaaaatgtgccagctacagaccacgtgatccggagggaagct
gagaccacgttctctgggagccactcctgttcaccttctcaccactgctccacagccacg
cccacctccagccacagacatgagagccacacgtggagcctggaacgttcagagagcctg
acctcggattcccagtcaggcatcatgctatcatcagtaggcaccagcaagtgcaacagc
ccagcatgtgtggaggcacgggcgcggagggcagcagcctacagccaggaggagcggcgc
agggctgccatgccaccctaccatgactccatagactcgctgcgtgactctccacacagt
gaaaggtacgtgtcagccttgaccacgcccgctcgcctctcgcccgtggacttccactac
tcgctggccacgcaggtgccgactttcgagatcacgtcgcccaactctgcgcatgccgtg
tcgctgccgcccgccgcgcccatcagctaccgcctggcggagcagcagccgctcctgcgg
catccagcgccgcccggcccggggccggggtcggggcccggagcggacatgcagcgcagc
tacgacagctactactaccctgcggcggggcccgggccgcggcgcagcgcctgcgcgctg
ggaggcagcttgggcagcctgcccgccagccccttccgcatcccggaggacgacgagtac
gagaccacgcaggagtgcgcgcccccgccgccgccgcggccgcgcacgcgcggcgcgtcc
cgcaggacgtcggcggggccgcggcgctggcggcgctcccggctcaacgggttggcggcg
cagcgcgcacgcgcggcgcgggactcgctgtcattgagcagcggttcgggctgcggctcg
gcgtcggcctcggacgacgacgcggacgacgcggacggggcgctggcggccgagagcacg
ccattcctcggcctgcgagcggcgcacgacgcgttgcgctcggactcgccgccgctgtgc
cccgcggccgacagcaggacttactactccctggacagccacagcacgcgcgccagcagc
agacacagccgggggccgcccacgagggccaagcaggactcggggcccctctaa

DBGET integrated database retrieval system