mmu:100044068 : No such data.

KEGG   Mus musculus (mouse): 26388
Entry
26388             CDS       T01002                                 

Gene name
Ifi202b, Ifbip-1, Ifi202, Ifi202a, Ifi202c, p20, p202
Definition
(RefSeq) interferon activated gene 202B
  KO
K12971  interferon-activable protein 202
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    26388 (Ifi202b)
SSDB
Motif
Pfam: HIN EKR
Other DBs
NCBI-GeneID: 26388
NCBI-ProteinID: NP_032353
MGI: 1347083
Ensembl: ENSMUSG00000026535
Vega: OTTMUSG00000050204
UniProt: Q9R002
LinkDB
Position
1; 1 H3
AA seq 445 aa
MSNRNLRSSTNSEFSEGQHQTPSSDSSGHGEDQPQASPGPNKKSHTPKKNISKGAVLHEK
PMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFN
SSGILEINETATVSEAAPNQIIEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKK
VNDKSITFKIKDNEDNIKVVWDKKQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFI
KGEKLLKESFEGDGYHKGPKQVVALKATKLFTYDSIKSKKMFHATVATDTEFFRVMVFEE
NLEKKFIPGNTIALSDYFGMYGSLAIHEYSSVSEVKSQNKEDSSSSDERLIEHLKICDLH
LQTKERLVDGEFKVYRKSTGNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCFE
LTSNADEWFLRSTRYSYMEVIMPEK
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtccaaccgtaacttaaggtcatctaccaactcagaattttctgagggtcaacatcag
accccttccagtgattcatctggccatggggaggatcaacctcaagcctctcctggacct
aacaaaaagtcacacaccccaaaaaagaacattagcaaaggtgctgttcttcatgagaaa
cccatgacagtgatggtactcactgcaacagaaccatttaattataaagagggaaaagag
aacatgtttcatgctacagtggctacagagagccaatattaccgtgtgaaagttttcaac
atggacttgaaagagaagttcacagaaaataaatttattaccatttccaaatacttcaac
agcagtggcatcctagagatcaatgaaactgccactgtgtcagaggctgctcctaaccaa
attattgaagtgcccaaaaatattatcagaagtgcaaaagaaactcttaagatctctaaa
attaaagaacttgattctggaacactgatttatggtgtgtttgcagtagagaagaaaaaa
gtgaatgataaaagtataaccttcaaaataaaagataatgaagataatataaaagtggtg
tgggataaaaaacagcacaatatcaactatgagaaaggagataaactccaactcttctcc
tttcacctgagaaaaggaaatgggaaaccaatattacactctggaaatcacagtttcatc
aagggagaaaagctactaaaagaatcttttgaaggggatggttaccacaaaggtcccaaa
caagtggtggcattgaaagcaacaaaactatttacttatgatagtataaaaagtaaaaag
atgttccatgccacagtggctactgatacagaattcttcagagtgatggtcttcgaggaa
aacctagagaaaaagtttatcccgggaaacaccattgctttatcagattattttggtatg
tatgggtctctggcaatacatgaatattccagcgtgtctgaggtgaagagccaaaataag
gaagactcaagttcatcagatgaaagactcatagaacatcttaaaatttgtgatcttcac
ttgcaaacaaaagaaaggctggttgatggagagtttaaagtatacaggaaaagtaccgga
aataattgtatatgctatggaatttgggatgatacaggagcaatgaaagtggtggtatct
ggacaactgaccagtgtcaactgtgagattggtaatacaattagacttgtctgctttgaa
ttgacctcaaatgcagatgagtggtttctgagatctacgaggtacagttacatggaggtc
atcatgcctgaaaaatga

DBGET integrated database retrieval system