mmu:100862456 : No such data.
mmu:102641086 : No such data.

KEGG   Mus musculus (mouse): 17749
Entry
17749             CDS       T01002                                 

Gene name
Polr2k, ABC10-, ABC10-alpha, Maf, MafY, Mt1, Mt1a, RPA, RPABC4, RPB, RPB1, RPB10alpha, RPB12, RPB7, RPB7.0
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide K
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    17749 (Polr2k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    17749 (Polr2k)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    17749 (Polr2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    17749 (Polr2k)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17749 (Polr2k)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     17749 (Polr2k)
  RNA polymerase III system
   RNA polymerase III
     17749 (Polr2k)
  RNA polymerase I system
   RNA polymerase I
     17749 (Polr2k)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      17749 (Polr2k)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 DUF5816 MCM_OB HypA DZR zinc_ribbon_13
Other DBs
NCBI-GeneID: 17749
NCBI-ProteinID: NP_075616
MGI: 102725
Ensembl: ENSMUSG00000045996
Vega: OTTMUSG00000042372
UniProt: Q63871 Q8BFX0 Q545V5
LinkDB
Position
15; 15 B3.1
AA seq 58 aa
MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggacgctcagaaagatgttcaaccaccaaagcagcagccaatgatatatatttgtgga
gagtgtcacaccgaaaatgagataaagtccagggatcccatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaaaagattggtggtttttgatgctcgatga

KEGG   Mus musculus (mouse): 20016
Entry
20016             CDS       T01002                                 

Gene name
Polr1c, 40kD, 40kDa, AA409007, AA959927, AL024089, Polr1e, RP, RPA40, Rpo, Rpo1-1
Definition
(RefSeq) polymerase (RNA) I polypeptide C
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20016 (Polr1c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    20016 (Polr1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20016 (Polr1c)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     20016 (Polr1c)
  RNA polymerase I system
   RNA polymerase I
     20016 (Polr1c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 20016
NCBI-ProteinID: NP_033111
MGI: 103288
Ensembl: ENSMUSG00000067148
Vega: OTTMUSG00000028872
UniProt: P52432
LinkDB
Position
17; 17 C
AA seq 346 aa
MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYAGYDDAWDQNRFEKNFRVDVVQMDEDT
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPR
LFEYRNQGEEEGTEIDTLQFRLQVRCTRNPNAAKDSSDPNELYVNHKVYTRHMTWVPLGN
QADVFPEGTIRPVHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPAIT
LLEPVEGEAAEELSQCFSPGVIEVEEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggcggctcaggcggtggaggagatgcggactcgcgtggttctcggagagtttggg
gttcgcaatgtccacaccacggactttcccggtaactacgccggttatgatgatgcctgg
gaccagaaccgcttcgagaagaatttccgtgtggacgtggtgcaaatggatgaagacacg
ctggagttcgacatggtggggattgatgctgccatcgccaatgctttccggagaatcctg
ttagctgaggtgccgacaatggccgtggagaaggtcttggtgtataacaacacgtccata
gtccaggatgagatccttgctcaccgcctggggctcatccccatcctcgctgatcctcgt
ctctttgaatatcggaaccaaggagaggaggaaggaacagagatagacacgctgcagttc
cggctgcaggtcaggtgtaccaggaaccccaatgctgccaaggattcctcagaccccaat
gaactctatgtcaaccataaagtctacaccaggcatatgacatgggtccccttgggaaat
caggctgatgtcttcccagagggcacaatccgtccagtgcacgacgacatcctcatcgct
cagcttcggcctggccaggaaattgacttgatgatgcattgcgtcaagggcattggcaaa
gaccatgccaagttctcaccagtggccacagccagctacagactgctaccggccatcact
ctgcttgagcctgtggaaggagaagcggctgaggagctgagccagtgtttctcccctggc
gtgattgaggtggaggaagtacaaggtaaaaaggtggccagggtggccaatgctcggctg
gataccttcagcagggaaatcttccggcatgagaaactcaagaaggctgtgcggcttgcc
cgggttcgggaccattatatcttttctgtggagtctactggagttttgccaccagatgtg
ttggtgagtgaagccatcaagatcctgatggggaagtgccggcggttcttggatgaactg
gatgcagttgagatggactga

KEGG   Mus musculus (mouse): 20018
Entry
20018             CDS       T01002                                 

Gene name
Polr1d, 1110003G10Rik, 16kD, AC19, RPA16, Rpo, Rpo1-3, mRP
Definition
(RefSeq) polymerase (RNA) I polypeptide D
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20018 (Polr1d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    20018 (Polr1d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20018 (Polr1d)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     20018 (Polr1d)
  RNA polymerase I system
   RNA polymerase I
     20018 (Polr1d)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 20018
NCBI-ProteinID: NP_033113
MGI: 108403
Ensembl: ENSMUSG00000029642
Vega: OTTMUSG00000024630
UniProt: P97304 Q545W2
LinkDB
Position
5; 5 G3
AA seq 133 aa
MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIM
KNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKD
YKAKKASKKEPTF
NT seq 402 nt   +upstreamnt  +downstreamnt
atggaagacgatcaggagctggagagaaaaatatcaggattgaagacctcaatggctgaa
ggcgagaggaagacagccctggaaatggtccaggcagctggaacagatagacagtgtgtg
acatttgtcctgcacgaggaggaccatacactaggaaactgtctgcggtacataatcatg
aagaacccggaagtggaattttgtggttacactacgacccatccttcagagagcaaaatt
aatttgcgaattcagacccggggtgcccttccagctgttgagccgtttcagaaaggcctg
aatgagctcttgaatgtctgccagcatgtgcttgtcaagtttgaggccagcataaaggac
tataaagctaaaaaggcaagcaaaaaggagcccacattctag

KEGG   Mus musculus (mouse): 218832
Entry
218832            CDS       T01002                                 

Gene name
Polr3a, 9330175N20Rik, BC053071, RP, RPC1, RPC155
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide A
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    218832 (Polr3a)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    218832 (Polr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    218832 (Polr3a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     218832 (Polr3a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     218832 (Polr3a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 218832
NCBI-ProteinID: NP_001074716
MGI: 2681836
Ensembl: ENSMUSG00000025280
UniProt: B2RXC6
LinkDB
Position
14; 14 A3
AA seq 1390 aa
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANF
IQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCVNDSYVTIQNSELMCGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVYPCQTEPALSKNDLTLTAEAIMKKNEFLC
CQDSFLQEIKTFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKANRDPKPPRRPLIFD
THEFHIPLVT
NT seq 4173 nt   +upstreamnt  +downstreamnt
atggtgaaggagcagttccgcgagacggatgtggctaagaaaataagccatatctgtttt
ggaatgaagtcccctgaggagatgcgccagcaggcacatatccaggttgtcagtaagaac
ctgtacagccaagacaacaaccacgcccccttgttgtatggagtgcttgaccatagaatg
ggtacgagcgaaaaagatcgtccttgtgagacctgtgggaagaacttggcggactgtctc
ggccactatggctacattgatctcgagctaccgtgctttcatgtcgggtacttcagggct
gtcattggtatcttacagatgatctgcaaaacctgctgccacattatgctgtcccaggaa
gagaagcagcagtttctagattttctgaagaggcctggcctaacctacctgcagaagcga
ggcctgaagaagaagatctcagataaatgccggaagaaaagcacttgtcactactgtggt
gcctttaatggtaccgtaaagaaatgtggtttactgaagataattcatgaaaaatacaag
acaaacaaaaaagtcgtggatcccattgtatcaaacttcctgcagtcctttgagacagcc
attgagcataacaaagaggttgaacccctgctgggaagggcccaggagaacttgaatcct
ttagtagttctgaacttgtttaagcgcatcccagctgaagatgtcccgttactcctgatg
aacccagaatctggaaagccctctgatttgattctcacccgacttttggtgcctcccctg
tgtatcagaccgtccgtcgtgagtgatctgaagtctggaaccaatgaagatgacctgaca
atgaaactgacagagatcattttcctaaatgatgttattaaaaagcaccggatctccgga
gccaagacgcagatgatcatggaggactgggatttcctgcagctgcagtgtgccctctac
atcaacagtgagctctctggcatccctctcaacatggcacctaagaaatggacgcgaggc
tttgtgcagcgcctgaaggggaaacagggtcgatttagaggtaatctgtcagggaagagg
gtggatttctccggccgaacagtcatctcacctgaccccaacctccggattgatgaagta
gccgtgccagttcatgtggccaaaattctaacttttcctgagaaggtgaacaaagcaaac
atcaactttttgaggaaactggttcgaaatggcccagatgttcacccaggagccaatttt
atccaacaaagacacatgcagatgaagaggttcctgaagtatggaaatcgggaaaagatg
gctcaggagctcaagttcggcgacattgtagagagacacctgatagatggagatgtggtc
ttgttcaaccggcagccctccctgcacaaactgagcatcatggcccacctggccagggtt
aagccccaccggaccttcagattcaatgaatgtgtctgcaccccctacaatgcagacttt
gatggggatgaaatgaaccttcatcttccccagacagaggaagccaaagcagaggccctt
gttctcatggggaccaaagcgaaccttgtaaccccacgaaatggggagccactcattgct
gccattcaggacttcttaacaggtgcttacctcctcaccctcaaggacaccttctttgac
cgagccaaggcttgccagatcatcgcttcaatactggttggcaaagatgaaaaaattaaa
gtgcgcctcccaccccctacaatactaaagcctgtcaccctgtggaccggaaagcagatc
ttcagtgtcatcctcagacctagtgatgacaatccagtgcgggccaacctccgaaccaag
ggcaagcagtactgtggcaagggggaagacctctgcgtcaacgactcctatgtcaccatc
cagaacagtgagttgatgtgcggcagcatggacaaagggaccctggggtcggggtccaag
aacaacatcttctacatcttgctacgagactgggggcagaatgaggctgccgatgccatg
tctcggcttgccaggctggctcctgtctacctgtctaaccgtgggttctccatcgggatt
ggtgatgtcacgcctggccagggactgctgaaagccaagtatgagctactaaatgctggc
tacaaaaaatgtgacgagtacattgaagccctgaacacaggcaagctgcagcagcagcca
ggctgcacggccgaggagacgcttgaggctctgatcctgaaggagctgtctgtgatccgg
gaccatgctggcagtgcctgcctccgcgagctggacaagagcaacagccccctcaccatg
gccctgtgtggctccaaaggttccttcataaacatatcacagatgattgcctgtgtggga
cagcaagccatcagtggctcccgggttccagatggctttgagaacagatctttgcctcac
tttgagaagcattcaaagctccctgctgccaaaggctttgtggccaatagcttttactct
ggcttaacgcctactgagtttttcttccacacaatggccggtcgggagggtctggtggac
acagctgtaaagactgctgaaacaggatacatgcagagaagactggtcaaatccctggaa
gacctctgctcgcagtacgatctgacagtgcggagctccaccggtgacatcatccagttc
atctatggaggagatggcttagatcctgctgccatggagggcaaagacgaaccgctggag
tttaagcgggttctggacaacatcaaggcagtgtatccatgtcagactgaacctgctctc
agtaagaacgacctcaccttgaccgctgaggccatcatgaagaagaatgagttcctatgc
tgccaagacagcttcctgcaggaaataaaaacattcattaaaggggtgtccgagaagatt
aagaaaaccagagataaatatgggatcaatgataacggcacaacagagcctcgtgtgctg
taccagttggaccgtattacccctacccaaatagagaagtttctggagacctgtagggat
aagtatatgagagcacagatggagccaggctctgcggtaggtgcactctgtgcacagagc
attggtgagcccggcacccagatgacgctgaagacattccactttgcaggagtagcctcc
atgaacatcaccctgggtgtgcctcggatcaaagagatcatcaacgcttccaaggccatc
agcactccaattatcacagcacagctagacaaggatgacgacgcggattatgcacgcctg
gtgaagggcaggattgagaaaaccctcctgggggagatctcagagtatattgaagaagtg
tttcttcctgatgactgctttattcttgtcaagctctccctggaacggatccgacttctg
agactggaggtcaatgctgagacagtgcggtactccatctgcacatccaagctccgagtg
aagcctggtgatgtggccgttcatggggaggctgtggtgtgtgtcacccccagggaaaac
agcaagagctccatgtattatgtgctgcagtttctcaaagaggatctgcccaaggtggtt
gtacaaggcatcccagaggtgtcgcgagctgtcatccatattgacgagcagagtgggaag
gagaagttcaagcttctggtggaaggtgacaacctgcgggcagtcatggccacccacggt
gtgaaaggcacccggaccacgtctaataacacctatgaggtggaaaaaaccctgggcatt
gaggctgcccggacaactatcatcaacgagatccagtacacgatggtcaaccacggcatg
agcatcgacaggaggcacgtgatgctgctctctgacctgatgacctacaagggtgaagtc
ctgggtataaccaggtttggcctggccaagatgaaggagagtgtgttgatgctggcctcc
tttgaaaagacagctgaccatctctttgatgctgcctactttgggcagaaagactctgta
tgcggagtgtctgagtgcatcatcatgggaatcccgatgaacatcggaactgggctcttc
aagctgttacacaaagccaacagggaccccaaaccacccaggagacccctgatatttgac
acacatgaattccacatccctcttgttacatag

KEGG   Mus musculus (mouse): 245841
Entry
245841            CDS       T01002                                 

Gene name
Polr2h
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide H
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    245841 (Polr2h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    245841 (Polr2h)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    245841 (Polr2h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    245841 (Polr2h)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    245841 (Polr2h)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     245841 (Polr2h)
  RNA polymerase III system
   RNA polymerase III
     245841 (Polr2h)
  RNA polymerase I system
   RNA polymerase I
     245841 (Polr2h)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      245841 (Polr2h)
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 245841
NCBI-ProteinID: NP_663607
MGI: 2384309
Ensembl: ENSMUSG00000021018
Vega: OTTMUSG00000035122
UniProt: Q923G2
LinkDB
Position
16; 16 B1
AA seq 150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcgggcatcctgttcgaggatattttcgatgtgaaagacatcgacccagaaggcaag
aaatttgaccgagtatcccggctgcactgtgagagtgaatctttcaagatggacctcatc
ttagatgtaaacattcagatttaccctgtggacttaggtgacaagttccggttggttata
gctagtactttgtatgaagatggtaccttggatgatggtgaatacaaccccacagatgac
aggccttccagggctgaccagtttgagtatgtcatgtatgggaaagtgtacaggatcgaa
ggggatgagacctccactgaagcagccacacgcctctctgcgtacgtgtcctatgggggc
ctgctcatgaggcttcagggtgatgccaacaacctgcatggatttgaggtggactccaga
gtttatctgctgatgaagaagctggccttctga

KEGG   Mus musculus (mouse): 26939
Entry
26939             CDS       T01002                                 

Gene name
Polr3e, RP, RPC5, Sin
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide E
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    26939 (Polr3e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    26939 (Polr3e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    26939 (Polr3e)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     26939 (Polr3e)
SSDB
Motif
Pfam: Sin_N zf-TFIIB
Other DBs
NCBI-GeneID: 26939
NCBI-ProteinID: NP_079574
MGI: 1349452
Ensembl: ENSMUSG00000030880
Vega: OTTMUSG00000059323
UniProt: Q9CZT4 Q3TWE8
LinkDB
Position
7; 7 F2
AA seq 710 aa
MANEEDDPVIQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTARYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEEDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGMRDSRSEHERQYLLCQGSSGVENTELVK
SPSEYLMMLMPPSPEEEKDKPVAPSNVLSMAQLRTLPLADQIKVLMKNVKVMPFANLMSL
LGPSVDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGMPAEVLCRGRDFVMWKF
TQSRWVVRKEVAAVTKLCAEDVKDFLEHMAVVRINKGWEFLLPYDLEFIKKHPDVVQRQH
MLWSGIQAKLEKVYNLVKETMPKKPDGQSAPVGLVSGEQRVQTAKTKAQQNHAFLERELQ
RRKEQMRAATVLPSVQIKEEPLSEEEADGAELEAEEEEPMDTAPSTCLSTKLANGLPAGR
AVGGDSLNGHPVPGCASNPVACELKAFVEATFQRQFVLTLSELKRLFNLHLAGLPPGHIL
FSGVSDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFS
KNYRVRRNLIQSRLTQECGEELSKQEVDKVLKDCCVSCGGMWYLKGTVQS
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggccaatgaagaagatgacccagtcatacaggagatcgatgtgtacttggctaaaagt
ctggcagagaagctgtatctctttcagtatcctgtgcgtcctgcttcaatgacctatgat
gacattccacatctctcagccaagatcaagcccaaacagcagaaggtagagcttgagatg
gccatcgacaccctgaatcccaactactgccgcagcaaaggggagcagatcgcactgaac
gtggacggtgcctgtgctgacgagactagcacatattcctcaaagctgatggacaagcag
accttctgctcctcccagaccaccagcaacacagctcgttatgccgctgcactctacagg
caaggtgagctccacctgacacctttacatggcatcctacagcttcggcccagcttctcc
taccttgataaggcagatgccaagcaccgagagagggaggcagccaatgaggcaggggat
tcttctcaggacgaggcagaagaagacgttaagcagatcacggtacggttctccaggcca
gagtccgagcaggctcgccagcgccgcgtgcagtcctatgagttcttgcagaagaagcat
gcagaagaaccctgggtccacctgcactactatggcatgagggacagccgctcagagcat
gagcgccagtacctgctgtgtcagggatccagcggggtagagaacacggagctcgtcaag
tcacccagtgaatacctcatgatgctcatgccgcccagcccagaggaggagaaggacaag
cctgtggctcccagcaatgtcttatctatggcccagctgcgtacattgcctctggctgat
cagattaaggtcctgatgaagaacgtgaaagtcatgcccttcgctaatctcatgagcctc
ctgggcccctctgtggactctgtggctgttctacgtggcatccagaaggtggcgatgtta
gtccaaggaaactgggtggtaaagagtgacatcctgtatcccaaggattcttccagccct
cacagtggcatgcctgctgaggtgctctgcaggggccgagactttgttatgtggaagttc
acacagagccgatgggtggtaagaaaggaggtggcagcagtgaccaaactctgcgctgag
gatgtgaaggactttctggagcacatggctgtagtgagaatcaacaaaggctgggagttc
ttactgccttacgacctggagtttatcaagaagcatccagatgtggtccagcggcagcac
atgctgtggtcgggcatccaggccaaattagaaaaagtctataatctcgtaaaagaaacc
atgccaaagaagccggatggacaatcagcgcctgttggtctggtctctggggaacagcgg
gtccaaacagccaaaaccaaggcccagcagaaccatgccttcttggagcgtgaactgcag
cgacggaaggagcagatgcgggcagccacagtcctgcccagcgtgcagatcaaggaggaa
cccctgagtgaggaggaagccgatggggctgagctggaggctgaggaagaggagcccatg
gacactgcacccagcacttgcctcagcaccaagttggccaatgggctgcctgctgggcgg
gcagtgggtggggacagcctaaatggacacccagttccaggctgtgccagcaacccggtt
gcctgtgaactgaaggcttttgtggaagccacctttcagagacagtttgtgctcacgctg
agcgaactcaagcgcctcttcaacctgcacctggcaggcctgcccccgggccatatactc
ttcagtggcgtctcagaccgaatgctacaggatacggtgctggccgctggctgcaagcag
atactggtgccttttcccccacagactgctgcttcccctgatgagcagaaggtatttgcc
ctctgggagtctggagacatgagtgaccagcatcggcaggttttgcttgaaatattttcc
aaaaattaccgagtacgtcggaacttgatccagtctcggctgactcaagaatgtggagaa
gagctaagcaaacaggaggtggataaagtgctaaaggactgttgtgtaagctgtggtggc
atgtggtaccttaaggggacagtacaatcctga

KEGG   Mus musculus (mouse): 66420
Entry
66420             CDS       T01002                                 

Gene name
Polr2e, 2410021N14Rik, 25kD, 25kDa, AW208866, RP, RPB5, XA, XAP4
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    66420 (Polr2e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    66420 (Polr2e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    66420 (Polr2e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66420 (Polr2e)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66420 (Polr2e)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     66420 (Polr2e)
  RNA polymerase III system
   RNA polymerase III
     66420 (Polr2e)
  RNA polymerase I system
   RNA polymerase I
     66420 (Polr2e)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      66420 (Polr2e)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 66420
NCBI-ProteinID: NP_079830
MGI: 1913670
Ensembl: ENSMUSG00000004667
Vega: OTTMUSG00000019133
UniProt: Q80UW8 Q3V214
LinkDB
Position
10; 10 C1
AA seq 210 aa
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atggacgacgaggaggagacctaccggctgtggaagatccgcaagacgatcatgcagctg
tgtcatgaccgtggctacctggtgacccaggatgaactggaccagacacttgaggaattc
aaggcgcagtttggggacaagcccagcgaaggacggccaaggcgcacagacctcacggtg
ctggtggcccacaacgatgaccccacagaccagatgtttgtgttcttcccagaggagccc
aaggtgggcatcaagaccatcaaggtatactgccagcgcatgcaggaggaaaacatcaca
cgggcgctgattgtggtgcagcagggcatgacgccctccgccaagcagtccctggtggac
atggccccgaagtatgtgctggaacagtttctacagcaggagctgctcatcaatatcaca
gagcacgagctagtccctgagcacgtggtcatgacaaaggaggaggtgactgaactgctg
gctcgatacaagcttcgtgagagccagctacccagaatccaggccggggacccagtggca
cggtactttgggatcaagcgagggcaggtcgtgaagatcatccgccccagtgagacggct
ggccgctacatcacctaccgcctggtgcagtag

KEGG   Mus musculus (mouse): 66491
Entry
66491             CDS       T01002                                 

Gene name
Polr2l, 2510029B14Rik
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide L
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    66491 (Polr2l)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    66491 (Polr2l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    66491 (Polr2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66491 (Polr2l)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66491 (Polr2l)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     66491 (Polr2l)
  RNA polymerase III system
   RNA polymerase III
     66491 (Polr2l)
  RNA polymerase I system
   RNA polymerase I
     66491 (Polr2l)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      66491 (Polr2l)
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 66491
NCBI-ProteinID: NP_079869
MGI: 1913741
Ensembl: ENSMUSG00000038489
Vega: OTTMUSG00000028947
UniProt: P62876
LinkDB
Position
7; 7 F5
AA seq 67 aa
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatcccggtgcgctgcttcacctgcgggaagatcgtcggcaacaaatgggaagcc
tacctgggtctgctgcaggccgagtacacggagggggatgccctggacgctctgggccta
aagcgctactgctgccgccgcatgctgctagcacacgtggacctgattgagaagctgctg
aactatgcacccctagagaagtga

KEGG   Mus musculus (mouse): 67005
Entry
67005             CDS       T01002                                 

Gene name
Polr3k, 12.3kD, 12.3kDa, 1500004O14Rik, AI196849, AU014893, C11, RPC, RPC10, RPC11
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide K
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67005 (Polr3k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67005 (Polr3k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67005 (Polr3k)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67005 (Polr3k)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Lar_restr_allev Nudix_N_2 zf-SAP30 Baculo_LEF5_C Zn_ribbon_recom
Other DBs
NCBI-GeneID: 67005
NCBI-ProteinID: NP_080177
MGI: 1914255
Ensembl: ENSMUSG00000038628
Vega: OTTMUSG00000016835
UniProt: Q9CQZ7 Q3TSW1
LinkDB
Position
2; 2 H4
AA seq 108 aa
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
NT seq 327 nt   +upstreamnt  +downstreamnt
atgctgttgttctgcccgggctgcgggaacggactcattgtggaggaggggcagcgttgc
catcgcttcgcctgcaacacttgcccctacgtccataatatcacccgtaaggtaacaaac
cgaaagtatccaaagctaaaagaagtggacgacgtgcttggtggagcagctgcatgggag
aatgtggactctactgcagagccatgtccaaaatgcgaacatccccgtgcctacttcatg
cagcttcagacgcgttctgcagacgagccaatgaccaccttctataagtgctgcaatgct
cagtgtggacatcgctggagggattaa

KEGG   Mus musculus (mouse): 67065
Entry
67065             CDS       T01002                                 

Gene name
Polr3d, 2810426M17Rik, 44kD, 44kDa, AI326118, AW489084, BN51, BN51T, RP, RPC4, TSBN, TSBN51
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide D
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67065 (Polr3d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67065 (Polr3d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67065 (Polr3d)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67065 (Polr3d)
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 67065
NCBI-ProteinID: NP_001157554
MGI: 1914315
Ensembl: ENSMUSG00000000776
UniProt: Q91WD1
LinkDB
Position
14; 14 D2
AA seq 398 aa
MSEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQL
PLAHSGWLFKEESEEPEAKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAAR
KTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVV
IKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcggaaggaaacgcggcgggcgagcccagcaatcctggagggccgcgaccccttctc
tctgggggccgggggctgatcggccggcggcccgcacccccgcttacgcccggtcgcctt
ccctccatccgctcccgggacctcacccttggcggagtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaagaagagccaaaagaagaagtgactatgaagaaggaa
aagcgtgaacgggacagggaccgccagcgtgagggtcacggacggggacgtggccgcccg
gaagtgatccagtcccattctatcttcgagcagggtccggcagaaatgatgaaaaaaaaa
gggaactgggataagaccgtggacatgtccgacatgggaccttctcatatcatcaacatc
aaaaaagagaagagagaaacagacgaagagaccaagcagatcctgcgcatgctggagaag
gatgacttcatcgatgacccggggctaaagaatgacacacggaacatgccagtgcagctg
cctctggctcattcagggtggctttttaaggaggagagtgaagagccagaggctaagcct
ttttcggctggccccaaggaagaagatatggaggtggacgtgcctgccgtcaaagtgaaa
gaggagccacgagatgaggaagaggaagccaaggtgaaagcccctccaagagcagcccgg
aagactcctggcctcccaaaggacgtgtcggtggccgagctgctcagagagctgagcctc
atgaaggatgaggagctcctgttccttcagctgcctgacaccctccccgggcagccaccc
actcaggacatcaagcctgtcaagacagaggtgcagggcgaggatggacagatggtagtc
ataaagcaggaaaaagaccgggaagccaggctagcagagaatgcttgtaccttggctgac
ctgacagagggtcaagtgggcaaactgctcatccgtaagtcagggaaggtgcaactcctc
ctgggcaaggtgactctagatgtgaccatgggaacgacctgttctttcctgcaggaactg
gtgtctgtgggccttggagacagcagaacaggggagatgacagtcctgggacatgtgaag
cacaaacttgtatgttctcctgattttgaatctctcttggatcacaaacaccggtga

KEGG   Mus musculus (mouse): 67486
Entry
67486             CDS       T01002                                 

Gene name
Polr3g, 2310047G20Rik, AV275904, RPC, RPC32, RPC7
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide G
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67486 (Polr3g)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67486 (Polr3g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67486 (Polr3g)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67486 (Polr3g)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 BUD22 AAR2
Other DBs
NCBI-GeneID: 67486
NCBI-ProteinID: NP_001074645
MGI: 1914736
Ensembl: ENSMUSG00000035834
Vega: OTTMUSG00000035047
UniProt: Q6NXY9
LinkDB
Position
13; 13 C3
AA seq 223 aa
MAGNKGRGRAAYTFNIEAVGFSRGEKLPDVVLKPPPLFPDTDYKPVPLKTGEDEDYMLAL
KQELRETVKRLPYFIEPPEEKQDDIERYSKRYMKVYKEEWVPDWRRLPREMMPRKKCKKG
DPKSKPSKAAAKATSLINSADVLKTIEELEKRGEGERSDEENEEKEGSKEKDKDDEEDGE
EDAEQEDYDEEEQEEENDYINSYFDNGDDFGVDSDDNMDEATY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctggcaataaaggaagagggcgtgctgcctacacctttaatatcgaagctgttgga
ttcagcagaggggagaagttacctgatgttgtgttgaagcctccacccctgtttcctgat
acagactacaagccggtgcccctgaaaacgggagaagatgaggattacatgctggccttg
aagcaggagttgagggaaacagtgaaacgattgccgtactttattgaaccacccgaagaa
aaacaagatgatattgaaaggtatagcaaacgatacatgaaggtctataaagaagaatgg
gtaccagattggagaagacttccaagagagatgatgccaaggaaaaaatgcaaaaaaggg
gatccaaaatccaagccgagcaaagctgcagccaaggctacatcactcattaattctgca
gatgtgttgaaaacgattgaggaactggaaaagagaggcgagggtgaaagatcggatgaa
gaaaacgaagagaaagaagggagcaaagagaaagataaagatgatgaggaggatggcgag
gaagatgcagaacaggaggactacgatgaagaggaacaagaagaggagaatgactacatt
aactcctacttcgacaacggcgatgattttggtgtagacagcgacgacaacatggatgaa
gccacctactag

KEGG   Mus musculus (mouse): 69833
Entry
69833             CDS       T01002                                 

Gene name
Polr2f, 1810060D16Rik, RPB6
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide F
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    69833 (Polr2f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    69833 (Polr2f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    69833 (Polr2f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69833 (Polr2f)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69833 (Polr2f)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     69833 (Polr2f)
  RNA polymerase III system
   RNA polymerase III
     69833 (Polr2f)
  RNA polymerase I system
   RNA polymerase I
     69833 (Polr2f)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      69833 (Polr2f)
SSDB
Motif
Pfam: RNA_pol_Rpb6 BDHCT_assoc
Other DBs
NCBI-GeneID: 69833
NCBI-ProteinID: NP_081507
MGI: 1349393
Ensembl: ENSMUSG00000033020
UniProt: P61219
LinkDB
Position
15 E1; 15 37.7 cM
AA seq 127 aa
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcagacaacgaggacaatttcgacggcgacgactttgatgacgttgaggaggacgaa
ggacttgacgacttggaaaatgctgaggaggagggccaggaaaatgtcgagattctccca
tctggtgagcgaccacaggccaaccagaagcggatcaccactccttacatgaccaagtat
gagcgggcccgggtgctgggcacccgggctcttcagatcgcgatgtgtgccccggtgatg
gtggagctggagggggagacagaccctttgctcatcgccatgaaggaactcaaggcgcgg
aagatccccatcatcattcgccggtacctgccagacggcagctatgaggactggggcgtg
gacgagcttatcatcagcgactga

KEGG   Mus musculus (mouse): 69870
Entry
69870             CDS       T01002                                 

Gene name
Polr3gl, 2010003I19Rik
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide G like
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    69870 (Polr3gl)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    69870 (Polr3gl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69870 (Polr3gl)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     69870 (Polr3gl)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 Pox_Ag35 DUF913 NPR3 DUF4746
Other DBs
NCBI-GeneID: 69870
NCBI-ProteinID: NP_081517
MGI: 1917120
Ensembl: ENSMUSG00000028104
Vega: OTTMUSG00000032756
UniProt: Q8R0C0
LinkDB
Position
3; 3 F2.1
AA seq 218 aa
MASRGGGRGRGRGQLTFNMEAVGIGKGDALPPPTLQPSPLFPPLEFHPVPLPAGEEGEYV
LALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPSELKIR
VRKVQKERTTIILPKRPPKSTDDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEGEE
EEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY
NT seq 657 nt   +upstreamnt  +downstreamnt
atggccagccggggtgggggccggggtcgtggccggggccagttgaccttcaacatggag
gctgtgggcattgggaagggtgatgctttgcccccacccactctccagccctctccactc
tttcctcccttggagttccacccagtgcctctgccggcaggagaggagggggagtatgtc
ctggcactgaagcaagagctgcgcggggccatgaggcagctcccctacttcatccggcca
gccgtccccaagagagatgtggaacgttactcagacaagtatcagatgtctgggcctatt
gacaacgccatcgattggaaccctgattggcggcgactccccagtgagctcaagattcga
gtgcggaaagtacagaaggagcggaccaccattatccttcccaagaggccccctaagagc
acagacgataaggaggagacgatacagaaactagagacgctagagaagaaggaggaggaa
gtgacttcggaggaggatgaagagaaagaagaagaggaggagaaggaagagggggaggaa
gaggaatacgatgaagaggagcatgaggaggaaactgattacatcatgtcatattttgac
aatggagaggactttggaggggacagcgatgacaatatggatgaggccatatactga

KEGG   Mus musculus (mouse): 70408
Entry
70408             CDS       T01002                                 

Gene name
Polr3f, 2810411G20Rik, 3010019O03Rik, 3110032A07Rik, RP, RPC, RPC39, RPC6
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide F
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    70408 (Polr3f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    70408 (Polr3f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    70408 (Polr3f)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     70408 (Polr3f)
SSDB
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Other DBs
NCBI-GeneID: 70408
NCBI-ProteinID: NP_084039
MGI: 1924086
Ensembl: ENSMUSG00000027427
Vega: OTTMUSG00000004234
UniProt: Q921X6 Q8C108
LinkDB
Structure
PDB: 
2DK8

Position
2; 2 G1
AA seq 316 aa
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPL
TEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVL
NQQCFKFLQSKAETARESKQNPVIQRNSSFASSHEVWKYICELGISKVELSMEDIETILN
TLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPILPPTGVVRAPCGLCPVFEDCHEGG
EISPSNCIYMTEWLEF
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcggaggtgaaggtcaaggtgcagccgccggacgcggatccggtggagatagaaaac
agaattatagaattatgccaccagttccctcatggaatcacagatcaagtaattcagaac
gaaatgcctcacattgaagcccagcagcgggcagtggccatcaatagactgttatccatg
ggtcagttggatcttttaaggagtaacacaggcctcttatatagaataaaggattctcag
aatgctggtaaaatgaaggggtccgataaccaggaaaaactggtctatcaaatcatagag
gatgcagggaataaaggaatatggagcagagatattcggtacaaaagtaacttgccgtta
acagaaatcaacaaaattctcaagaatttggaaagtaaaaagctaattaaagccgtgaag
tctgtagcagcttccaaaaagaaggtttatatgctctataacctgcagccagaccgatct
gtgactggcggtgcctggtacagtgaccaggattttgaatctgaatttgttgaggtgctt
aatcaacagtgtttcaaattcctacaaagcaaggcagagacagcaagagaaagtaaacag
aatccagtgatacaaagaaatagttcatttgcatcgtcacatgaagtctggaagtacatc
tgtgagctgggcatcagcaaggtagagttgtccatggaggacattgaaaccatcttgaac
acactcatttatgatggcaaagtggagatgactatcattgctgcgaaggaaggcactgtt
ggcagcgtagatggacacatgaaactgtacagggcagtcaacccaatcctcccacctaca
ggcgtggtccgggcaccctgtggactctgccccgtttttgaggactgccatgaaggtggt
gagatttcgccgtctaattgtatttacatgacagagtggcttgaattttaa

KEGG   Mus musculus (mouse): 70428
Entry
70428             CDS       T01002                                 

Gene name
Polr3b, 2700078H01Rik, A330032P03Rik, C128, C85372, RP, RPC2
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide B
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    70428 (Polr3b)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    70428 (Polr3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    70428 (Polr3b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     70428 (Polr3b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     70428 (Polr3b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 70428
NCBI-ProteinID: NP_081699
MGI: 1917678
Ensembl: ENSMUSG00000034453
Vega: OTTMUSG00000063526
UniProt: P59470
LinkDB
Position
10; 10 C1
AA seq 1133 aa
MDVLAEEFGSLTPEQLTAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLAKYNE
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggatgttctagccgaggagttcgggagcctgactccggagcagctgactgcgccgatc
ccgactgtggaggaaaaatggaggctgcttccagcatttttaaaggttaaaggcctggtg
aaacagcacatagactcctttaactatttcattaatgtagagataaagaagataatgaaa
gccaatgaaaaggttacaagtgatgctgaccccatgtggtacttaaaataccttaatatc
tatgtcggacttcctgatgttgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtctgagggacatgacgtactccgccccaatcacagtggacattgagtatacc
cgaggcagccagaggataatccgcaacgccttacccattggcagaatgcccatcatgctc
cgaagctcgaactgtgttctaacagggaaaacgccggcagagtttgccaaactgaatgag
tgtccactagacccaggtggctacttcattgttaaaggagtggaaaaagtcattcttatc
caagagcagctgtccaagaacaggatcattgtggaggccgacaggaaaggagccgttgga
gcctcagttaccagctccacccatgagaagaaaagcagaaccaacatggccgtgaaacag
ggtcgattctatctgaggcacaacaccctgtctgaagatatccccattgtcatcatattt
aaggccatgggtgtggagagtgaccaggaaatcgtgcagatgattggaacagaggagcac
gtgatggctgcatttgggcccagcttggaggagtgccagaaagctcagatcttcacccag
atgcaggcattgaagtatatagggaataaagtaagaagacaaagaatgtggggaggtgga
ccaaagaaaaccaaaatagaagaagcaagagaactcctggcttctaccattctgacccac
gtaccagtgaaggaattcaatttccgagctaagtgtatctacactgcagtgatggtgcga
agggtgatcctggcccaaggagataacaaggtcgatgacagagactattatggcaacaaa
cgactggaattggcaggacagctcttatctcttctttttgaagatttgtttaaaaagttt
aattcagaaatgaagaagattgcagaccaagtgattcctaaacagagagcagcccagttt
gacgtcgttaaacacatgcgccaagaccagattaccaacggcatggtcaatgccatctcc
acgggaaattggtctctgaagagatttaagatggaccgacagggtgtgacccaggtgctg
tctcgcttgtcatatatatctgcactcggcatgatgacaagaatctcttcccagtttgaa
aagacgaggaaagtgagtggccctcgttctctgcagccgtctcagtggggaatgctctgt
ccctccgacacacctgaaggggaggcctgtggtttggttaagaacttggccctcatgaca
catataacaactgacatggaagatggacccattattaagttagctgggaacttgggagta
gaagatgtgaatttattatgtggagaagagctctcttacccaaatgtgtttcttgtcttc
ctgaatggtaacatccttggtgtcattcgagaccataaaaagcttgtcagcacattccgg
ctgatgcgaagagcaggctatatcaatgaatttgtttctatctccacaaaccttacggat
cgctgtgtttatatttcctctgatggcgggcgcttgtgcaggccttacataattgttaag
aaacaaaagccagctgtcacaaataagcacatggaagagttggctcaaggctacaggaat
tttgaagatttcttacatgaaagtctagttgaatacttagatgtgaatgaagaaaatgac
tgtaacattgcgctctacgaacatacaattaataaagacaccacccacttggagattgaa
cccttcactctgcttggtgtttgtgccggcctgatcccataccctcatcacaaccagtct
ccaagaaacacctaccagtgtgctatgggcaagcaagccatgggtaccattggctacaat
caacggaacagaattgatacacttatgtatctactagcatatccacaaaagcccatggtt
aaaacaaaaacaatcgagttgatagattttgagaagttgccggctggccagaacgcaact
gttgccgtgatgagctacagcggctatgacattgaggacgcgctggttttgaacaaggcc
tctctggacagaggttttgggcgttgtcttgtgtataaaaatgctaagtgcaccttgaaa
cgatacaccaatcagacctttgataaggtgatgggtcccatgttggatgctgctaccaga
aaacccatctggcgacatgaaattttagatgcagatggcatttgttctccaggtgagaaa
gtggaaaacaaacaggtgcttgtaaacaagtccatgcccacagtgacacagattcctttg
gaagggagcaacgtgccacagcaaccacagtataaagatgtgcctatcacgtacaaaggt
gcgacagactcctacatcgagaaagtgatgatctcttccaacgccgaggatgctttcctc
atcaagatgctcctgagacagacgcggcgcccagagattggagacaaattcagcagtcgc
catggacaaaagggtgtctgtggcctgatcgtcccccaggaagacatgccgttctgtgat
tctggcatctgtcccgacatcataatgaacccacacggcttcccatcaagaatgacggtt
ggaaagttaattgagctgctggctggcaaggcaggcgtgttagacggcaggttccactac
ggcactgcctttggagggagtaaagtgaaggatgtgtgtgaagatctcgttcgccatggt
tacaactacctggggaaggactacgtcacctcaggcatcacaggtgagcccttagaagca
tacatctattttggacctgtgtattatcagaaactgaaacacatggtgctggataaaatg
cacgcccgggcccgaggaccacgagctgtccttaccaggcagcccactgaagggcggtcg
cgcgatggtggcttgcgacttggagaaatggaacgcgactgtctaatcggctatggagcg
agtatgcttttgctggagagactaatgatctcaagtgatgcctttgaggttgacgtctgc
gggcagtgtggactcctgggatattctggctggtgccactactgcaaatcttcgtgccac
gtgtcctccctccgcatcccgtatgcctgcaagctgctcttccaggagttacagtccatg
aacatcatccccaggctgaaactggccaagtacaacgagtaa

KEGG   Mus musculus (mouse): 74414
Entry
74414             CDS       T01002                                 

Gene name
Polr3c, 4933407E01Rik, RP, RPC, RPC3, RPC62
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    74414 (Polr3c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    74414 (Polr3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    74414 (Polr3c)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     74414 (Polr3c)
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9
Other DBs
NCBI-GeneID: 74414
NCBI-ProteinID: NP_083201
MGI: 1921664
Ensembl: ENSMUSG00000028099
Vega: OTTMUSG00000033832
UniProt: Q9D483 B2RX77
LinkDB
Position
3; 3 F2.1
AA seq 533 aa
MTQAEIKLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHH
NLVLYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSA
VVKKVADRLTETMEDGKTMDYAEVSNAFVRLADTHFVQRCPLVPDTDSSDRGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDATGEPKAKKPRYTDNKEPSPDDGIYWQVNLDR
FHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSSAPYTQPLSSNEIFRSLPVGY
NISKQVLDQYLTLLADDPLEFIGKSGDSGGGMFVINLHKALASLATATLESVIQERFGSR
CARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFILLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEE
VQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgactcaagcagagattaaactgtgttctttgttgctgcaagagcattttggtgagatt
gtagaaaaaattggagtccacctagtcagaactggaagccagccacttagagtaattgcc
cacgacacaaaagcatccctggaccaggtgaaaaaagccctttgtgtcctcattcaccac
aacctggtcctctatcatgtgcacaagcgcggtgtggtggagtatgaagcccagtgcagc
cgggtactgaggatgcttaggtatccccggtacatctacaccaccaaaacgctgtacggt
gacaccggagagctgattgttgaggagctcctgctgaatggcaaaatgacaatgtcagct
gttgtgaagaaagtagccgaccgactcacagagaccatggaggatggcaagaccatggac
tacgctgaggtatcaaatgcatttgtgcgactggcagatactcactttgtacagcgctgt
cccctggttcctgacactgacagttctgaccgtgggccaccgccacccgccccaaccctt
gtcattaatgaaaaggacatgtacctagttcccaaactgagcttgataggaaaaggtaag
aggaggagatcatctgatgaagatgctactggagagcccaaggccaagaaaccaagatac
acagataacaaggagccctcaccagacgatgggatttattggcaagtcaacctcgacagg
ttccaccagcacttccgtgaccaagcaatcgtgagcgcagtggcaaaccgaatggaccag
acaagcagcgagatcgtgcggacgatgctccggatgagtgagatcaccactccctctagc
gccccctatactcagccgctgtcctccaatgagatcttcaggtccctgcccgtcggatat
aacatctctaaacaggttctcgatcagtacctcacgctgctggcagatgacccactagag
tttattggaaagtctggcgacagtggcggaggaatgtttgtcatcaacctccataaagca
ttagcgtccctagccactgcaactctggagtctgtcatccaggagagattcgggtctcgc
tgtgccaggatattccgtctggtattgcagaagaaacaccttgagcagaagcaggtggag
gactttgcaatgatccctgcgaaggaggcaaaggacatgctgtacaagatgctctcggaa
aacttcatcctgctgcaggaaattcctaagacgccagaccacgccccgtccaggaccttc
tatctgtacactgtgaatgtgctctcagctgccaggatgctgttgcacaggtgctataag
agcatagccaacttgatagaacggcgacagtttgaaacaaaggagaacaagcggctacta
gaaaagtctcagcgggtggaagccatcatggcatccatgcaggccacgggtgcagaggag
gtgcagctgcaggagatagaggagatgatcacagcccccgagcggcagcagctggagaca
ctgaaacgcaacgttaacaagttggacgccagtgagatccaggtggatgaaaccatcttc
ttactggaatcatacattgagagcaccatgaagaggcagtga

KEGG   Mus musculus (mouse): 78929
Entry
78929             CDS       T01002                                 

Gene name
Polr3h, 5031409G22Rik, RP, RPC8
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide H
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    78929 (Polr3h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    78929 (Polr3h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    78929 (Polr3h)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     78929 (Polr3h)
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 78929
NCBI-ProteinID: NP_084505
MGI: 1926179
Ensembl: ENSMUSG00000022476
UniProt: Q9D2C6
LinkDB
Position
15; 15 E1
AA seq 204 aa
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttcgtgctggtggagatggtggacaccgtgcgcatacccccgtggcagtttgagcgg
aaactcaacgattccattgctgaggagctgaacaagaaattggccaacaaggtcgtatac
aacgtgggactctgcatctgtctgtttgatatcaccaagctggaggacgcctatgtgttc
ccaggggatggagcatcccacaccaaagtccatttccgctacgtggtgtttcaccccttc
ctggatgagatcctcattgggaagatcaaaggctgcagcccagagggtgtgcacgtctct
ttagggttctttgatgacattctcatcccccctgagtcactgcagcagcctgccaagttt
gatgaagcggagcaagtgtgggtgtgggagtacgagacggaggaaggagcgcatgacctg
tacatggacactggggaggagatccgcttcagggtggtggatgagagctttgtggacaca
tcccccacaggacccagttccgccgaggctgcctcttcaagcgaggagctgcccaagaag
gaagcaccatatacacttgtgggatctatcagtgagccaggactaggccttctctcctgg
tggacgagcaactag

DBGET integrated database retrieval system