KEGG   Mus musculus (mouse): 103140Help
Entry
103140            CDS       T01002                                 

Gene name
Gstt3, AI118089
Definition
(RefSeq) glutathione S-transferase, theta 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103140 (Gstt3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103140 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    103140 (Gstt3)
   00983 Drug metabolism - other enzymes
    103140 (Gstt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103140 (Gstt3)
   05204 Chemical carcinogenesis
    103140 (Gstt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103140 (Gstt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103140 (Gstt3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103140 (Gstt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    103140 (Gstt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103140 (Gstt3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   103140 (Gstt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 103140
NCBI-ProteinID: NP_598755
MGI: 2143526
Ensembl: ENSMUSG00000001665
Vega: OTTMUSG00000031847
UniProt: Q99L20
LinkDB All DBs
Position
10; 10 C1
AA seq 241 aa AA seqDB search
MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG
DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF
PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHISVADLVAITELMHPVSA
GCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPPLMDPALKEKLKLSVQCLL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagctctacctggacctgatgtcccaaccctgccgtgctgtctacatcttc
gccaagaagaacggcatccccttccagctgcgtaccatagagctgcttaaaggtcagcag
tacacagattccttcgcccaggtgaaccctttgaggaaggtgccagctttgaaggatggg
gacttcgtcttggcagagagtgtggccatcttgttgtatctgagtagaaagtacaaggcc
cccgaccactggtaccctcaggatctgcagactcgagctcgtgtagacgagtacctggca
tggcagcacacagccctgcggagttgttgcaccagggccatgtggcagaagatgatgttc
cctgtgttcctgggacagcccgtacctcctgagatgctggcatccaccttggctgaactg
gatgggtgcctgcaggtgctagaggacaagttcctgcggaaccaggccttccttacagga
tcccatatttctgtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgcaaaatctttgagagccgacccaaactggctgcctggcgtcagagagtagaagcc
gaagtgggggagagcctcttccaggaggcccatgaagttgtcctgaaggccaaggatatg
cctcccttgatggaccctgccttgaaagagaagctgaagctctctgtgcagtgtttgtta
cactga

KEGG   Mus musculus (mouse): 14857Help
Entry
14857             CDS       T01002                                 

Gene name
Gsta1, Gst2-1
Definition
(RefSeq) glutathione S-transferase, alpha 1 (Ya)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14857 (Gsta1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14857 (Gsta1)
   00982 Drug metabolism - cytochrome P450
    14857 (Gsta1)
   00983 Drug metabolism - other enzymes
    14857 (Gsta1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14857 (Gsta1)
   05204 Chemical carcinogenesis
    14857 (Gsta1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14857 (Gsta1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14857 (Gsta1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14857 (Gsta1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14857 (Gsta1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14857 (Gsta1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14857 (Gsta1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 14857
NCBI-ProteinID: NP_032207
MGI: 1095417
Ensembl: ENSMUSG00000074183
Vega: OTTMUSG00000031890
UniProt: P13745
LinkDB All DBs
Structure
PDB: 

Position
9 E1; 9 43.65 cM
AA seq 223 aa AA seqDB search
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggcgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagaaggtatttta
gatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaag
actgccttggcaaaagataggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacatccaccta
ctggaagttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacagcct
ggcagccagagaaagcctcccatggatgcaaaacaaattcaagaagcaaggaaggctttc
aagattcagtga

KEGG   Mus musculus (mouse): 14858Help
Entry
14858             CDS       T01002                                 

Gene name
Gsta2, Gst2-2, Gstc-2, Gstc2
Definition
(RefSeq) glutathione S-transferase, alpha 2 (Yc2)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14858 (Gsta2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14858 (Gsta2)
   00982 Drug metabolism - cytochrome P450
    14858 (Gsta2)
   00983 Drug metabolism - other enzymes
    14858 (Gsta2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14858 (Gsta2)
   05204 Chemical carcinogenesis
    14858 (Gsta2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14858 (Gsta2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14858 (Gsta2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14858 (Gsta2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14858 (Gsta2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14858 (Gsta2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14858 (Gsta2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 14858
NCBI-ProteinID: NP_032208
MGI: 95863
Ensembl: ENSMUSG00000057933
Vega: OTTMUSG00000031004
UniProt: P10648
LinkDB All DBs
Structure
PDB: 

Position
9 E1; 9 43.65 cM
AA seq 222 aa AA seqDB search
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPL
LKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtatacagaaggtatttta
gatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaag
actgccttggcaaaagacaggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacgtccacctg
ctggaacttcttctctatgttgaagagcttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacatcct
ggcagccagagaaagcctcccttggatgcaaaacaaattgaagaagcaaggaaggttttc
aagttttag

KEGG   Mus musculus (mouse): 14859Help
Entry
14859             CDS       T01002                                 

Gene name
Gsta3, Gst2-3
Definition
(RefSeq) glutathione S-transferase, alpha 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14859 (Gsta3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14859 (Gsta3)
   00982 Drug metabolism - cytochrome P450
    14859 (Gsta3)
   00983 Drug metabolism - other enzymes
    14859 (Gsta3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14859 (Gsta3)
   05204 Chemical carcinogenesis
    14859 (Gsta3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14859 (Gsta3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14859 (Gsta3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14859 (Gsta3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14859 (Gsta3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14859 (Gsta3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14859 (Gsta3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14859
NCBI-ProteinID: NP_001070821
MGI: 95856
Ensembl: ENSMUSG00000025934
Vega: OTTMUSG00000026333
UniProt: P30115
LinkDB All DBs
Position
1 A4; 1 6.5 cM
AA seq 221 aa AA seqDB search
MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEI
DGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEAS
LAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPL
LKALRSRVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagccagtccttcattactttgatggcaggggaagaatggagcctatccgg
tggctcttggctgcagctggtgtggagtttgaagaaaaatttctgaaaactcgggatgac
ctggcaaggttacgaagtgatgggagtctgatgttccagcaagtgcccatggtagagatc
gacgggatgaaactggtgcagaccaaagccattctcaactacattgcctccaaatacaac
ctctatgggaaggacatgaaggagagagccatcattgacatgtacacagaaggagtggcg
gatctggagataatgattctctattacccccacatgccccctgaggagaaagaggcaagc
cttgccaagatcaaggaacaaaccaggaaccgttacttccctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaacaggctgagcagggctgatattgccctg
gttgaactcctctaccatgtggaagagctggacccgggcgttgtggacaacttccctctc
ctgaaagcgctgagaagcagagtcagcaacctccccacagtgaagaagtttcttcaacct
ggcagccagaggaagccttttgatgacgcaaaatgtgttgagtcagcaaagaagattttc
agttaa

KEGG   Mus musculus (mouse): 14860Help
Entry
14860             CDS       T01002                                 

Gene name
Gsta4, GST5.7, mGsta4
Definition
(RefSeq) glutathione S-transferase, alpha 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14860 (Gsta4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14860 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    14860 (Gsta4)
   00983 Drug metabolism - other enzymes
    14860 (Gsta4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14860 (Gsta4)
   05204 Chemical carcinogenesis
    14860 (Gsta4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14860 (Gsta4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14860 (Gsta4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14860 (Gsta4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14860 (Gsta4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14860 (Gsta4)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14860 (Gsta4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14860
NCBI-ProteinID: NP_034487
MGI: 1309515
Ensembl: ENSMUSG00000032348
Vega: OTTMUSG00000062950
UniProt: P24472
LinkDB All DBs
Structure
PDB: 

Position
9; 9 E1
AA seq 222 aa AA seqDB search
MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEES
YDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaacctaagctctactactttaatggcaggggacggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaggaagaatttcttgagacaagggaacag
tatgagaagatgcaaaaggatggacacctgcttttcggccaagtacccttggttgaaatc
gatgggatgatgctgacacagaccagggccatcctcagctacctcgctgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgcagatggcacccag
gacctgatgatgatgattgccgtggctccatttaaaacccccaaggaaaaagaggagagc
tatgatttgatactgtcaagagctaaaacccgttacttcccagtgtttgaaaagatttta
aaagaccacggagaggcttttctcgttggcaaccagctcagttgggcagacatccagctc
ctagaagccattttgatggtggaagaactcagtgcccctgtactgtccgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaaccc
ggaagtcagaggaagcctcctccagatggcccctatgttgaggtggtcaggactgtcctg
aagttctag

KEGG   Mus musculus (mouse): 14862Help
Entry
14862             CDS       T01002                                 

Gene name
Gstm1, Gstb-1, Gstb1
Definition
(RefSeq) glutathione S-transferase, mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14862 (Gstm1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14862 (Gstm1)
   00982 Drug metabolism - cytochrome P450
    14862 (Gstm1)
   00983 Drug metabolism - other enzymes
    14862 (Gstm1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14862 (Gstm1)
   05204 Chemical carcinogenesis
    14862 (Gstm1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14862 (Gstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14862 (Gstm1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14862 (Gstm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14862 (Gstm1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14862 (Gstm1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14862 (Gstm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 14862
NCBI-ProteinID: NP_034488
MGI: 95860
Ensembl: ENSMUSG00000058135
Vega: OTTMUSG00000007188
UniProt: P10649
LinkDB All DBs
Position
3; 3 F2.3
AA seq 218 aa AA seqDB search
MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgatactgggatactggaacgtccgcggactgacacacccgatccgcatgctc
ctggaatacacagactcaagctatgatgagaagagatacaccatgggtgacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaagctgggcctggactttcccaatctg
ccttacttgatcgatggatcacacaagatcacccagagcaatgccatcctgcgctacctt
gcccgaaagcaccacctggatggagagacagaggaggagaggatccgtgcagacattgtg
gagaaccaggtcatggacacccgcatgcagctcatcatgctctgttacaaccctgacttt
gagaagcagaagccagagttcttgaagaccatccctgagaaaatgaagctctactctgag
ttcctgggcaagaggccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccaagtgcctggacgccttcccaaac
ctgagggacttcctggcccgcttcgagggcctcaagaagatctctgcctacatgaagagt
agccgctacatcgcaacacctatattttcaaagatggcccactggagtaacaagtag

KEGG   Mus musculus (mouse): 14863Help
Entry
14863             CDS       T01002                                 

Gene name
Gstm2, Gstb-2, Gstb2
Definition
(RefSeq) glutathione S-transferase, mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14863 (Gstm2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14863 (Gstm2)
   00982 Drug metabolism - cytochrome P450
    14863 (Gstm2)
   00983 Drug metabolism - other enzymes
    14863 (Gstm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14863 (Gstm2)
   05204 Chemical carcinogenesis
    14863 (Gstm2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14863 (Gstm2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14863 (Gstm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14863 (Gstm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14863 (Gstm2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14863 (Gstm2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14863 (Gstm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 Tom37 GST_N_2
Motif
Other DBs
NCBI-GeneID: 14863
NCBI-ProteinID: NP_032209
MGI: 95861
Ensembl: ENSMUSG00000040562
Vega: OTTMUSG00000007189
UniProt: P15626
LinkDB All DBs
Position
3; 3 F2.3
AA seq 218 aa AA seqDB search
MPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQAMDTRIQLAMVCYSPDF
EKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPN
LKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMAFWNPK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgacactaggttactgggacatccgtgggctggctcacgccatccgcctgctc
ctggaatacacagacacaagctatgaggacaagaaatacaccatgggggacgctcctgac
tatgaccgaagccagtggctgagtgagaagttcaagctgggcctggactttcccaatctg
ccctacttgattgatggatcacacaagatcacccagagcaatgccatcctgcgctacctt
gcccgaaagcacaacctgtgtggagagacagaggaggagaggattcgtgtggacattttg
gagaaccaggctatggacacccgcatacagttggccatggtttgctacagccctgacttt
gagaaaaagaagccagagtacttagagggtctccctgagaagatgaagctctactctgag
tttctgggcaagcagccatggtttgcagggaacaaggtcacctatgtggattttcttgtt
tatgatgtccttgatcaacaccgaatatttgagcccaagtgcctggatgccttcccaaac
ctgaaggacttcatgggtcgctttgagggcctgaagaagatatctgactacatgaagagc
agccgcttcctctccaagccaatctttgcaaagatggccttttggaacccaaagtag

KEGG   Mus musculus (mouse): 14864Help
Entry
14864             CDS       T01002                                 

Gene name
Gstm3, Fsc2, mGSTM5
Definition
(RefSeq) glutathione S-transferase, mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14864 (Gstm3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14864 (Gstm3)
   00982 Drug metabolism - cytochrome P450
    14864 (Gstm3)
   00983 Drug metabolism - other enzymes
    14864 (Gstm3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14864 (Gstm3)
   05204 Chemical carcinogenesis
    14864 (Gstm3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14864 (Gstm3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14864 (Gstm3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14864 (Gstm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14864 (Gstm3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14864 (Gstm3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14864 (Gstm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_3 WD40_alt
Motif
Other DBs
NCBI-GeneID: 14864
NCBI-ProteinID: NP_034489
MGI: 106026
Ensembl: ENSMUSG00000004038
Vega: OTTMUSG00000007193
UniProt: P19639
LinkDB All DBs
Position
3; 3 F2.3
AA seq 218 aa AA seqDB search
MPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDF
EKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
LRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgacactgggctattggaacacccgcggactgactcactccatccgcttgctc
ctggaatacacagattcaagctatgaggagaagagatatgtcatgggggatgcccccaac
tttgaccgaagccagtggctgagtgagaaattcaatcttggcctggattttcccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggagagacagaggaggagaggatccgtgtggatactttg
gagaaccaagttatggacacccgcatacagctcatgatagtctgctgcagtcccgatttt
gagaagcagaagccagagttcttgaaggccatccctgagaaaatgaagctctactctgag
ttcctgggcaagaggccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtatcgtatgtttgagcccaagtgcctggacgccttcccaaac
ctgagggacttcctggcccgcttcgagggcctcaagaagatctctgcctacatgaagagt
agccgcttcctcccaagacctgtgtttactaagatagcccagtggggcactgattag

KEGG   Mus musculus (mouse): 14865Help
Entry
14865             CDS       T01002                                 

Gene name
Gstm4, 1110004G14Rik, GSTM7-7, Gstb-4, Gstb4
Definition
(RefSeq) glutathione S-transferase, mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14865 (Gstm4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14865 (Gstm4)
   00982 Drug metabolism - cytochrome P450
    14865 (Gstm4)
   00983 Drug metabolism - other enzymes
    14865 (Gstm4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14865 (Gstm4)
   05204 Chemical carcinogenesis
    14865 (Gstm4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14865 (Gstm4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14865 (Gstm4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14865 (Gstm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14865 (Gstm4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14865 (Gstm4)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14865 (Gstm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 14865
NCBI-ProteinID: NP_001153883
MGI: 95862
Ensembl: ENSMUSG00000027890
Vega: OTTMUSG00000007184
UniProt: A2AE91
LinkDB All DBs
Position
3; 3 F2.3
AA seq 184 aa AA seqDB search
MGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYIARKHNLCGETEEEK
IRVDILENQAMDVSNQLARVCYSPDFEKLKVEYLEQLPGMVKLFSQFLGQRTWFVGEKIT
FVDFLAYDILDLHLIFEPTCLDAFPNLKDFVARFEVLKRISAYMKTSRFLRTPLYTKVAT
WGNK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgctcctgactatgaccgaagccagtggctgagtgagaagttcaaattgggc
ctggactttcccaatttgccttacttgattgatgggtcacacaagatcacgcagagcaat
gccatcctgcgctacattgcccgcaagcacaacctgtgtggggagacagaggaagagaag
attcgcgtggacattttggagaaccaggctatggatgtctccaatcagctggctcgagtc
tgttacagcccagactttgagaaactgaaggtggaatacttggagcagctccctggaatg
gtgaagctcttctcacagttcctgggccagcggacatggtttgttggtgaaaagattact
tttgtagatttcctggcttacgatatcctggacctgcaccttatattcgaacccacgtgc
ctggacgccttcccaaacctgaaggactttgtggcccgctttgaggtactgaagaggatc
tctgcttacatgaagaccagccgcttcctccgaacacccctatatacaaaggtggccact
tggggcaataagtag

KEGG   Mus musculus (mouse): 14866Help
Entry
14866             CDS       T01002                                 

Gene name
Gstm5
Definition
(RefSeq) glutathione S-transferase, mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14866 (Gstm5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14866 (Gstm5)
   00982 Drug metabolism - cytochrome P450
    14866 (Gstm5)
   00983 Drug metabolism - other enzymes
    14866 (Gstm5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14866 (Gstm5)
   05204 Chemical carcinogenesis
    14866 (Gstm5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14866 (Gstm5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14866 (Gstm5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14866 (Gstm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14866 (Gstm5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14866 (Gstm5)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14866 (Gstm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 14866
NCBI-ProteinID: NP_034490
MGI: 1309466
Ensembl: ENSMUSG00000004032
Vega: OTTMUSG00000035923
UniProt: P48774
LinkDB All DBs
Position
3; 3 F2.3
AA seq 224 aa AA seqDB search
MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEAPDYDRSQWLDVKFKLDLDF
PNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYN
SNHENLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRIFEPKCLDE
FPNLKAFMCRFEALEKIAAFLQSDRFFKMPINNKMAKWGNKCLC
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaagtctatggttctgggttactgggatatccgcgggctggctcatgctatc
cgcatgcttctggagtttactgataccagctatgaggagaaacggtacatctgtggggaa
gctcctgactatgatagaagccaatggctggacgtgaaattcaagctagatctggacttt
cctaacctgccctacctcatggacgggaagaacaagatcacccagagtaacgccatcctg
agatacatcgcacgcaagcacaacatgtgtggtgacactgaagaagaaaagatacgagta
gacatcatggagaaccagatcatggacttccgcatgcagctggttcgcctctgctacaat
tctaaccacgaaaacctgaagcctcagtacttggaacagctacctgcacagctgaaacaa
ttctcattgttcctggggaaattcacatggtttgcaggagaaaagctgacctttgtggat
tttctcacctatgatgtcttggatcagaaccgtatatttgagcccaagtgtctggatgag
ttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaagattgctgcattc
ctgcagtctgaccgcttcttcaagatgccaatcaataacaagatggccaagtggggtaac
aagtgcttatgctga

KEGG   Mus musculus (mouse): 14867Help
Entry
14867             CDS       T01002                                 

Gene name
Gstm6
Definition
(RefSeq) glutathione S-transferase, mu 6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14867 (Gstm6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14867 (Gstm6)
   00982 Drug metabolism - cytochrome P450
    14867 (Gstm6)
   00983 Drug metabolism - other enzymes
    14867 (Gstm6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14867 (Gstm6)
   05204 Chemical carcinogenesis
    14867 (Gstm6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14867 (Gstm6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14867 (Gstm6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14867 (Gstm6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14867 (Gstm6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14867 (Gstm6)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14867 (Gstm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 14867
NCBI-ProteinID: NP_032210
MGI: 1309467
Ensembl: ENSMUSG00000068762
Vega: OTTMUSG00000007100
UniProt: O35660
LinkDB All DBs
Position
3; 3 F2.3
AA seq 218 aa AA seqDB search
MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQWLNDKFKLDLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGMLCYSADF
EKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDVLDQHRMFEPTCLDAFPN
LKDFMARFEGLRKISAYMKTSRFLPSPVYLKQATWGNE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgactctgggttattgggatatccgtggactgggtcacgccatccgcctgctc
ctggaatacacagaaacaggctatgaagagaagagatacgccatgggggacgctcctgac
tatgacagaagccagtggctgaatgacaagttcaagctggacctggactttcccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggagagacagaggaggagaggatccgtgtggacattttg
gagaaacaggtcatggacactcgaattcagatgggcatgctttgctacagcgctgacttt
gagaaacggaagccagagttcttgaagggcctcccagatcagctgaaactctactcggag
ttcctggggaagcagccatggtttgcaggggacaagatcacctttgcagacttcctcgtc
tatgatgtccttgatcagcatcgaatgtttgaacccacgtgcctggacgccttcccaaac
ctgaaggacttcatggcccgctttgagggcctgaggaagatctctgcctatatgaagacc
agccgcttccttccaagtcctgtgtacttaaaacaggccacgtggggcaatgagtaa

KEGG   Mus musculus (mouse): 14869Help
Entry
14869             CDS       T01002                                 

Gene name
Gstp2, GSTpiA, Gst-3, Gst3
Definition
(RefSeq) glutathione S-transferase, pi 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14869 (Gstp2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14869 (Gstp2)
   00982 Drug metabolism - cytochrome P450
    14869 (Gstp2)
   00983 Drug metabolism - other enzymes
    14869 (Gstp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14869 (Gstp2)
   05204 Chemical carcinogenesis
    14869 (Gstp2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14869 (Gstp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14869 (Gstp2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14869 (Gstp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14869 (Gstp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14869 (Gstp2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14869 (Gstp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 14869
NCBI-ProteinID: NP_861461
MGI: 95864
Ensembl: ENSMUSG00000038155
Vega: OTTMUSG00000046063
UniProt: P46425
LinkDB All DBs
Position
19 A; 19 3.75 cM
AA seq 210 aa AA seqDB search
MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgtacaccattgtctacttcccaagtccagggcggtgtgaggccatgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccaggtggatatggtgaatgatggggtggaggacctt
cgcggcaaatatggcaccatgatctacagaaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (mouse): 14870Help
Entry
14870             CDS       T01002                                 

Gene name
Gstp1, GstpiB
Definition
(RefSeq) glutathione S-transferase, pi 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14870 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14870 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    14870 (Gstp1)
   00983 Drug metabolism - other enzymes
    14870 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14870 (Gstp1)
   05204 Chemical carcinogenesis
    14870 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14870 (Gstp1)
   05215 Prostate cancer
    14870 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14870 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14870 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14870 (Gstp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14870 (Gstp1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14870 (Gstp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 14870
NCBI-ProteinID: NP_038569
MGI: 95865
Ensembl: ENSMUSG00000060803
Vega: OTTMUSG00000046062
UniProt: P19157
LinkDB All DBs
Structure
PDB: 

Position
19 A; 19 3.75 cM
AA seq 210 aa AA seqDB search
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccaccatacaccattgtctacttcccagttcgagggcggtgtgaggccatgcgaatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccagatggatatggtgaatgatggggtggaggacctt
cgcggcaaatatgtcaccctcatctacaccaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (mouse): 14871Help
Entry
14871             CDS       T01002                                 

Gene name
Gstt1, AI255817, Gstt1-1
Definition
(RefSeq) glutathione S-transferase, theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14871 (Gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14871 (Gstt1)
   00982 Drug metabolism - cytochrome P450
    14871 (Gstt1)
   00983 Drug metabolism - other enzymes
    14871 (Gstt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14871 (Gstt1)
   05204 Chemical carcinogenesis
    14871 (Gstt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14871 (Gstt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14871 (Gstt1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14871 (Gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14871 (Gstt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14871 (Gstt1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14871 (Gstt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 14871
NCBI-ProteinID: NP_032211
MGI: 107379
Ensembl: ENSMUSG00000001663
Vega: OTTMUSG00000026319
UniProt: Q64471 Q9DCY6
LinkDB All DBs
Position
10 C1; 10 38.58 cM
AA seq 240 aa AA seqDB search
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF
PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGG
GCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPPADLIIKQKLMPRVLAMIQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggttctggagctgtacctggatctgctgtcgcagccctgtcgcgccatttatatcttc
gccaagaagaacaatatcccgttccagatgcacacggtggagctgcgcaagggtgagcac
ctcagcgatgcgtttgcccgggtgaaccccatgaagagggtaccagccatgatggatggt
ggcttcaccctgtgtgagagtgtggctatcttgctctacctggcacacaagtataaggtt
cctgaccactggtacccccaagacctgcaggctcgtgctcgtgtagacgagtacctggca
tggcagcatacgggccttcggagaagctgcctcagggccctgtggcataaggtgatgttc
cctgttttccttggtgagcaaatacctcctgaaacactggcagccacgttggcagaactg
gatgttaacctacaggtgcttgaagacaagttcctccaggacaaagacttccttgttggg
ccccacatctccctggccgacttggtggccatcacagagctgatgcatcctgtaggtggt
ggctgcccagtctttgaagggcatcccaggctggctgcatggtaccagcgagtggaggca
gctgtggggaaggacctcttccgggaagcccatgaagtcatcctgaaggtgaaggactgt
ccccctgctgacctcatcataaagcagaagctgatgcccagagtgctggcaatgatccag
tga

KEGG   Mus musculus (mouse): 14872Help
Entry
14872             CDS       T01002                                 

Gene name
Gstt2, AI266894, Yrs, mGSTT2
Definition
(RefSeq) glutathione S-transferase, theta 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14872 (Gstt2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14872 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    14872 (Gstt2)
   00983 Drug metabolism - other enzymes
    14872 (Gstt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14872 (Gstt2)
   05204 Chemical carcinogenesis
    14872 (Gstt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14872 (Gstt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14872 (Gstt2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14872 (Gstt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14872 (Gstt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14872 (Gstt2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14872 (Gstt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14872
NCBI-ProteinID: NP_034491
MGI: 106188
Ensembl: ENSMUSG00000033318
UniProt: Q61133
LinkDB All DBs
Position
10 C1; 10 38.58 cM
AA seq 244 aa AA seqDB search
MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALG
YNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggagctctacctggacctgctgtcacaacccagccgcgctgtctacatcttc
gccaagaagaatggcatccccttccagacgcgtaccgtggatatactcaaagggcagcac
atgagcgagcaattctcccaggtgaactgcttaaacaaagttcctgtactcaaagacgga
agcttcgtgttgaccgaaagcacagccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggc
tggcatgccgacaacatccgtggtactttcggagtgctcctatggaccaaggtgttgggg
ccactcattggggtccaggttccccaggagaaggtggaacggaacagagatagaatggtc
ctggttctgcaacagctggaggacaagttcctcagggacagggccttccttgttggccag
caggtgacgctagcggatctcatgtctctggaggagttgatgcagcccgtggctcttggc
tataacctgtttgagggacggcctcagctgacagcatggcgagagagggtggaggcgttc
ttgggtgctgagctgtgtcaggaggctcatagcaccatcctgagcatcctgggacaggca
gccaagaaaatgttaccagtaccccctccggaggtccatgccagcatgcagcttcgaatt
gctaggattccttga

KEGG   Mus musculus (mouse): 14873Help
Entry
14873             CDS       T01002                                 

Gene name
Gsto1, AA407097, AI194287, AU018802, Gsto-1, Gstx, Spg-r, p28
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14873 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14873 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    14873 (Gsto1)
   00983 Drug metabolism - other enzymes
    14873 (Gsto1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14873 (Gsto1)
   05204 Chemical carcinogenesis
    14873 (Gsto1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14873 (Gsto1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14873 (Gsto1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14873 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14873 (Gsto1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14873 (Gsto1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14873 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 14873
NCBI-ProteinID: NP_034492
MGI: 1342273
Ensembl: ENSMUSG00000025068
Vega: OTTMUSG00000028264
UniProt: O09131
LinkDB All DBs
Position
19; 19 D1
AA seq 240 aa AA seqDB search
MSGESSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKP
EWFFEKNPLGLVPVLENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESF
SKVPPLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWF
QRLEALELKECLAHTPKLKLWMAAMQQDPVASSHKIDAKTYREYLNLYLQDSPEACDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagaatcctccaggagcctggggaagggaagcgcgccccccggcccggtcccg
gagggccagatccgcgtctacagcatgaggttctgccccttcgctcagaggacgctgatg
gtcctgaaggccaagggaatccggcacgaagtcatcaatatcaacctgaagaataagccc
gagtggttctttgagaagaatccccttgggctggtgccggttctggagaacagccagggt
cacttggtcaccgaatctgtcatcacttgtgagtacctggatgaggcctacccagagaag
aagttatttccagatgacccgtacaagaaggcacgtcagaagatgacccttgagtcattc
tctaaggtgccgcctttgattgcaagctttgttaggtcgaagagaaaggaagactctccg
aacctaagggaagcgttggagaacgaattcaaaaagctagaggagggcatggataattac
aagagcttccttggtggggattctccttctatggttgattatcttacttggccttggttt
cagcgactggaagcattggagctcaaggagtgtctagcccacacccccaagctcaagctc
tggatggcggccatgcagcaagaccctgtggcatcctctcacaaaattgatgccaagacc
taccgcgagtacttaaatctctacctacaggacagccccgaggcctgtgattatgggctc
tga

KEGG   Mus musculus (mouse): 211666Help
Entry
211666            CDS       T01002                                 

Gene name
Mgst2, GST2, MGST-II
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    211666 (Mgst2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    211666 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    211666 (Mgst2)
   00983 Drug metabolism - other enzymes
    211666 (Mgst2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    211666 (Mgst2)
   05204 Chemical carcinogenesis
    211666 (Mgst2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    211666 (Mgst2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    211666 (Mgst2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    211666 (Mgst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    211666 (Mgst2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     211666 (Mgst2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   211666 (Mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 211666
NCBI-ProteinID: NP_001297411
MGI: 2448481
Ensembl: ENSMUSG00000074604
Vega: OTTMUSG00000030621
UniProt: A0A0A6YWX7
LinkDB All DBs
Position
3; 3 C
AA seq 82 aa AA seqDB search
MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFY
PVFIVMLWMAGWYFNQGSPVSD
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggccggggattcaagcctgctggctgcagtctctcttctctctgcctgtcagcaaagt
tatttcgcttggcgggtcggacgagcaagactaaaacacaagattgcacccccagcagtc
acgggccctctggaattcgagagaatatttcgtgcacagcaaaactctttggagttttat
cctgtattcatcgtaatgctgtggatggctgggtggtacttcaatcaaggatcaccggtt
tccgactga

KEGG   Mus musculus (mouse): 56615Help
Entry
56615             CDS       T01002                                 

Gene name
Mgst1, 1500002K10Rik, Gst
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    56615 (Mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    56615 (Mgst1)
   00982 Drug metabolism - cytochrome P450
    56615 (Mgst1)
   00983 Drug metabolism - other enzymes
    56615 (Mgst1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56615 (Mgst1)
   05204 Chemical carcinogenesis
    56615 (Mgst1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    56615 (Mgst1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    56615 (Mgst1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    56615 (Mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56615 (Mgst1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     56615 (Mgst1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   56615 (Mgst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 56615
NCBI-ProteinID: NP_064330
MGI: 1913850
Ensembl: ENSMUSG00000008540
Vega: OTTMUSG00000027063
UniProt: Q91VS7 Q53ZD4
LinkDB All DBs
Position
6; 6 G1
AA seq 155 aa AA seqDB search
MADLRQLMDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGENAK
KFVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIA
YLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctcaggcagctcatggacaatgaggtgttgatggcctttacctcctatgca
acgatcattcttaccaagatgatgttcatgagctctgcgaccgcattccagaggataacc
aacaaggtttttgccaacccagaagactgcgctggctttggcaagggagagaatgccaag
aagtttgttcgcactgacgagaaggtggaacgcgtgcgcagagcccacctgaatgatctt
gaaaacatcgttccctttctcggcatcggcctcctgtactccctgagtggaccagatctc
tctacagccctcatgcacttcagaatctttgtaggtgctcggatctaccacaccattgct
tacttgactccccttcctcagccaaacaggggcttggcattttttgttggctatggagtt
actttgtcaatggcttacaggctgctaaggagcagactgtacttgtaa

KEGG   Mus musculus (mouse): 66447Help
Entry
66447             CDS       T01002                                 

Gene name
Mgst3, 2010012L10Rik, 2010306B17Rik, 2700004G04Rik, AA516734, GST-III
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    66447 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    66447 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    66447 (Mgst3)
   00983 Drug metabolism - other enzymes
    66447 (Mgst3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    66447 (Mgst3)
   05204 Chemical carcinogenesis
    66447 (Mgst3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    66447 (Mgst3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    66447 (Mgst3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    66447 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    66447 (Mgst3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     66447 (Mgst3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   66447 (Mgst3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 66447
NCBI-ProteinID: NP_079845
MGI: 1913697
Ensembl: ENSMUSG00000026688
Vega: OTTMUSG00000022623
UniProt: Q9CPU4
LinkDB All DBs
Position
1; 1 H2.3
AA seq 153 aa AA seqDB search
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL
ALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggagtatggatttgtgcttctcactggtgctgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaacgggcatatgttcaactgcattcagcgcgcc
caccagaacacgttggaggtgtaccctcccttcctgtttttcctaacggtgggaggtgtt
taccacccgcgcatagcttctggcctgggcctggcctggattattgggcgagtcctttac
gcatatggctactacacaggagaccctagcaagcggtatcgaggagccgtgggctctctt
gccctctttgccctgatgggcaccaccgtgtgctctgctttccagcatctcggctggatc
agaccaggcttaggctacgggtccagatcctgccaccactga

KEGG   Mus musculus (mouse): 68214Help
Entry
68214             CDS       T01002                                 

Gene name
Gsto2, 1700020F09Rik, 4930425C18Rik, GSTO_2-2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    68214 (Gsto2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    68214 (Gsto2)
   00982 Drug metabolism - cytochrome P450
    68214 (Gsto2)
   00983 Drug metabolism - other enzymes
    68214 (Gsto2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    68214 (Gsto2)
   05204 Chemical carcinogenesis
    68214 (Gsto2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    68214 (Gsto2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    68214 (Gsto2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    68214 (Gsto2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68214 (Gsto2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     68214 (Gsto2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   68214 (Gsto2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 68214
NCBI-ProteinID: NP_080895
MGI: 1915464
Ensembl: ENSMUSG00000025069
Vega: OTTMUSG00000028267
UniProt: Q8K2Q2 Q9D2S1 Q8BW12
LinkDB All DBs
Position
19; 19 D1
AA seq 248 aa AA seqDB search
MSGDLSRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSKP
DWYYTKHPFGQIPVLENSQCQLVYESVIACEYLDDVYPGRKLFPYDPYERARQKMLLELF
CKVPPLSKECLIALRCGRDCTDLKVALRQELCNMEEILEYQNTTFFGGDCISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWIASMKQDPAVCALHTDKSVFLGFLNLYFQNNPCAFDF
GLCNPIIR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggatttgtcaagatgcttgggaaaaggaagctgtcccccagggccggtccct
gagggtgtgatccgaatctacagcatgaggttctgcccctactcgcacagggcacgcctg
gttctcaaggccaaaggcatcaggcatgaagtgatcaatattaacctgaaaagcaagcct
gactggtactatacaaagcatccttttggccaaattcctgtcttggagaacagccagtgt
cagctggtctatgaatctgtcattgcttgtgagtacctggatgacgtctacccgggaaga
aagctgtttccgtatgacccgtatgaacgagctcgccagaagatgttattggagctattc
tgtaaggtcccgcctttaagcaaggaatgtctgatagcgctgagatgcggaagagactgt
acggatctgaaggtcgccctgcgtcaggagttgtgcaacatggaagagattcttgaatat
cagaacactaccttcttcggcggagactgtatatccatgattgattacctcgtctggccc
tggtttgagcgcctggacgtatatggactggctgactgcgtgaatcacaccccgatgctg
cggctctggatagcctccatgaagcaggaccctgcagtgtgtgctctgcacactgataag
agcgtcttcctgggcttcttgaatctctatttccaaaacaacccttgtgcctttgatttt
gggctgtgtaacccaatcatacgataa

KEGG   Mus musculus (mouse): 68312Help
Entry
68312             CDS       T01002                                 

Gene name
Gstm7, 0610005A07Rik, AI894236, Cd203c
Definition
(RefSeq) glutathione S-transferase, mu 7
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    68312 (Gstm7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    68312 (Gstm7)
   00982 Drug metabolism - cytochrome P450
    68312 (Gstm7)
   00983 Drug metabolism - other enzymes
    68312 (Gstm7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    68312 (Gstm7)
   05204 Chemical carcinogenesis
    68312 (Gstm7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    68312 (Gstm7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    68312 (Gstm7)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    68312 (Gstm7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68312 (Gstm7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     68312 (Gstm7)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   68312 (Gstm7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 Bromo_TP GST_N_2
Motif
Other DBs
NCBI-GeneID: 68312
NCBI-ProteinID: NP_080948
MGI: 1915562
Ensembl: ENSMUSG00000004035
Vega: OTTMUSG00000007101
UniProt: Q80W21
LinkDB All DBs
Structure
PDB: 

Position
3; 3 F2.3
AA seq 218 aa AA seqDB search
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADF
EKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPN
LKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactgggttactgggacatccgtgggctagcccatgccattcgcctgttc
ctggaatacacagactcaagctatgaggagaagagatacaccatgggtgatgctcctgac
tatgaccaaagccagtggctgaatgagaaattcaagctgggcctggactttcctaacctg
ccctacttgatcgatgggtcacacaagatcacgcagagcaatgccatcctgcgctacctt
ggccgcaagcacaacctgtgtggggagacagaggaggaaaggatccgtgtggatattctg
gagaatcagcttatggacaaccgcatggtgctggcgaggctttgctacaacgctgacttt
gagaagctgaagccagggtacctggagcaactccctggaatgatgaggctttactctgag
ttcctgggcaagcggccatggttcgcaggggacaagatcacctttgtggatttcattgct
tacgatgtgcttgagaggaaccaagtgtttgaggccaagtgcctggatgcgttcccaaac
ctgaaggacttcatagcgcgctttgagggcctgaagaagatctccgactacatgaagacc
agtcgcttcctcccaagacccatgttcacaaagatggcaacttggggcagcaattag

KEGG   Mus musculus (mouse): 75886Help
Entry
75886             CDS       T01002                                 

Gene name
Gstt4, 4930583C14Rik, AI507011
Definition
(RefSeq) glutathione S-transferase, theta 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    75886 (Gstt4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    75886 (Gstt4)
   00982 Drug metabolism - cytochrome P450
    75886 (Gstt4)
   00983 Drug metabolism - other enzymes
    75886 (Gstt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    75886 (Gstt4)
   05204 Chemical carcinogenesis
    75886 (Gstt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    75886 (Gstt4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    75886 (Gstt4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    75886 (Gstt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    75886 (Gstt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     75886 (Gstt4)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   75886 (Gstt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 75886
NCBI-ProteinID: NP_083748
MGI: 1923136
Ensembl: ENSMUSG00000009093
Vega: OTTMUSG00000027939
UniProt: Q9D4P7
LinkDB All DBs
Position
10; 10 C1
AA seq 240 aa AA seqDB search
MGLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDG
KFILSESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLII
PMITGEEVPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGS
NHNVFVSSKLAEWRMRVELAIGSGLFWEAHERLVKLPNWDCSTLDPTIKMRICDFLQKFK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacatggatctgctgtcggcgccttgccgcgctgtctacattttt
gccaggaagaatggcatccccttcgacttccaatttgtggatctattaaaaggtcaccac
catagcaaggaatacatcgaaatcaaccccctgaggaagcttcccagcctcaaggacggc
aagttcatcttatctgaaagtgtggctatcctcttctacctatgtcgcaagtacagtgcg
ccttcccattggtacccaccggatctgcacatgcgtgcccgcgtggacgagtttatggcc
tggcagcatacagctattcaggtgcccatgagcaagatcctgtggattaagttgataatc
ccaatgatcacgggtgaggaggttcccactgagagattagagaagacactggatgaggtg
aagagaaacctacagcaatttgaggagaagtttctgcaggacaagatgttcatcactggg
gaccatatctcactggctgacttggtggcgctggtagaaatgatgcagccaatggggagt
aatcacaatgtctttgtcagctctaagcttgcagaatggcgaatgcgggtggagttagcc
atcggctctggcctcttctgggaggctcatgaaagactggtgaagttaccaaactgggac
tgttcgacactagaccctacgatcaagatgaggatttgtgactttctgcagaagtttaag
tga

DBGET integrated database retrieval system