KEGG   Mus musculus (mouse): 103964Help
Entry
103964            CDS       T01002                                 

Gene name
Try5, 1810049H19Rik, Tc, Tesp4
Definition
(RefSeq) trypsin 5
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04972  Pancreatic secretion
mmu04974  Protein digestion and absorption
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103964 (Try5)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    103964 (Try5)
   04974 Protein digestion and absorption
    103964 (Try5)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    103964 (Try5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    103964 (Try5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    103964 (Try5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103964 (Try5)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103964 (Try5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103964 (Try5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103964
NCBI-ProteinID: NP_001003405
MGI: 102756
Ensembl: ENSMUSG00000036938
Vega: OTTMUSG00000026909
UniProt: Q9QUK9
LinkDB All DBs
Position
6; 6 B1
AA seq 246 aa AA seqDB search
MNSLLFLALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKTRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLN
ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKIT
NNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQ
DTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcctgttcctggcccttgtgggagctgctgttgctttccctgtggatgat
gatgacaagatcgttggaggatacacctgccgagagaattctatcccctaccaggtgtct
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcattgctacaaaacccgcatccaagtgagactgggagagcacaacatcaatgtc
ctcgagggcaatgagcagtttgtcaattctgccaagatcatcaagcatcccaacttcaat
agcaggaccctgaacaacgacatcatgctgatcaaactggcttcccctgtgaccctcaat
gccagagtggccactgtggctctgcccagctcctgtgcacctgcaggcactcagtgtctc
atctctggctggggcaacaccttgagctttggtgtgaacaacccagacctgcttcaatgc
ctggatgccccattgctacctcaggctgactgtgaggcctcttatcctggaaagatcacc
aataacatgatctgtgttggcttcctggagggaggcaaagattcctgccagggtgactct
ggtggtcctgtggtttgcaatggacagctccagggcattgtctcctggggctatggctgt
gccctgaaggacaaccctggtgtgtacaccaaggtctgcaactatgtggactggattcag
gacaccattgccgcaaactaa

DBGET integrated database retrieval system