KEGG   Mus musculus (mouse): 104099Help
Entry
104099            CDS       T01002                                 

Gene name
Itga9, (alpha)9, 2610002H11Rik, 6720458D17Rik, AI461869, D130073C02, D9Ertd428e
Definition
(RefSeq) integrin alpha 9
  KO
K06585  integrin alpha 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104099 (Itga9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104099 (Itga9)
   04514 Cell adhesion molecules (CAMs)
    104099 (Itga9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104099 (Itga9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104099 (Itga9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    104099 (Itga9)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    104099 (Itga9)
   05414 Dilated cardiomyopathy (DCM)
    104099 (Itga9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104099 (Itga9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    104099 (Itga9)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   104099 (Itga9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 104099
NCBI-ProteinID: NP_598482
MGI: 104756
Ensembl: ENSMUSG00000039115
Vega: OTTMUSG00000033312
UniProt: B8JK39
LinkDB All DBs
Position
9 F3; 9 70.32 cM
AA seq 1036 aa AA seqDB search
MGGPAAARTGAGGLRALLLALVAAGVPAGAYNLDAQRPVRFQGPSGSFFGYAVLEHFHDN
TRWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGRTRGAPCGKTCRGD
RDDEWMGVSLARQPRADGRVLACAHRWKNIYYEADHILPHGFCYLIPSNLQAKGKVLIPC
YEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTLKVLNLTDNTYFKLNDEAI
MNRRYTYLGYAVTAGHFSHPSITDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKK
MGSYFGSSLCAVDLNMDGLSDLLVGAPMFSEIRDEGQVTVYLNQGHGALEEQLTLTGDAA
YNAHFGESIANLGDIDDDGFPDVAVGAPKEEDFAGAVYIYHGDANGIVPKYSMKLSGRRL
NPTLRMFGQSISGGIDMDGNGYPDVTIGAFLSDSVVLLRARPVITVDVSIFLPGSINITA
PQCHDGQQPVNCLNVTVCFRFHGKNVPGEIGLNYNLTADVAQKEKGQLPRVYFVLFGETA
GQVSERLQLSHMDEVCHHYVAHVKRRVQDVISPIVFEAAYSLDEHVMGEEDRELPDLTPV
LRWKKGQRISQKNQTVFERNCQSEDCAADLQLRGKLLLSSVDEKTPHLALGAVKNISLNI
SISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKY
EFSVIFDTSHLSGEEEILSFIVTAQSGNLERSEALHDNTLTLTVPLVHEVDTSITGIVSP
TSFVYGESVDASNFIQLDDQECHFQPVNITLQVYNMGPSTLPGSSVSISFPSRLSPGGAE
MFQVQDMVVSQEKGNCSLQRNPTPCIIPQEQENIFHTIFAFFSKSGRKVLDCEKPGSFCL
TLHCNLSALPKEESRTINLYMLLNTEILKKDSSSVIQFMARAKVKVEPALRVVEIANGNP
EETLVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEK
NRKENEDGWDWVQKNQ
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcccggctgcggcgcggaccggcgccggagggctccgcgcgctgctgctggcg
ctggtggccgcgggggtcccggccggcgcctacaacctggacgcgcagcgcccggtacgc
ttccagggcccctcaggctccttcttcggctacgcggtgctggagcacttccacgacaac
acgcgctgggtcctcgtgggtgcaccgaaggcagattctaaatatagcacttcagtaaag
tctcctggagctgtgtttaagtgtcgtgtccataccaaccctgaccggagatgcaccgag
ctggacatggctcgagggaggactcgtggtgcgccctgtgggaagacctgcaggggagac
cgggatgacgagtggatgggggtgagcctggcccggcagcccagagcagatggccgtgtt
ttggcctgtgcccatcgttggaagaacatctactacgaagcagaccacatcctgccccat
ggattctgctacctcatcccttccaacctccaggccaaaggcaaggtgctgattccctgc
tacgaagagtataagaagaagtatggggaagaacatggctcctgccaggccggaatagca
ggcttcttcacagaggaactggtggtcatgggtgccccaggctcgttttattgggctggg
acactcaaggtgctgaacctcacggacaacacatattttaagttgaacgatgaagcgatt
atgaacagacggtatacttatctgggctatgcagtgacggctggccacttctctcatcca
tccatcactgatgtggtagggggtgccccacaggatgaaggcattggaaaggtttatata
tttagagctgaccgaagatcagggaccttaataaagatctttcaggcatcaggaaaaaag
atgggctcttacttcggctcctccttgtgtgcagtcgacctgaacatggacggcctctct
gacttgctcgtgggggctcccatgttttctgagatcagagatgaggggcaggtcaccgtc
tacctcaaccaaggacatggagccctcgaggaacagctgaccctgactggagatgccgcc
tacaacgcgcactttggggagagcatcgccaacctgggcgacattgatgatgacgggttc
ccagatgtggctgtcggggcacctaaggaggaggactttgctggcgcagtctacatctat
catggtgatgccaatgggattgtccccaagtactcaatgaagctgtctgggaggaggcta
aacccgaccctgcggatgtttgggcagtccatatcagggggcattgatatggatggaaat
ggctatcctgatgtcaccatcggagccttcctgtccgacagcgtggttctcctcagggcc
agaccggtcatcacggtggatgtctccatcttcctgccaggctccatcaacatcacagca
cctcagtgtcacgatggacaacagcctgtgaactgcctgaatgtcaccgtgtgcttccgg
ttccatggcaagaatgtaccaggagaaatcggtctgaactacaatctgacggctgatgtg
gcacagaaggagaagggccagctgcccagagtctattttgtgttgtttggagagacggca
gggcaggtctcagaaaggctgcagctgtcccacatggacgaagtgtgtcatcactacgtg
gcccacgtcaagcggagagtccaggatgtcatcagccccattgtgtttgaagccgcctac
agcctggatgagcatgtgatgggtgaggaagaccgggagctgccagacctgacaccagtg
cttcgctggaagaagggacaaaggatctcccagaagaatcagacagtttttgaaaggaat
tgccaatctgaggactgtgctgccgacctgcagcttcgggggaaactcctgctttccagt
gttgacgagaaaaccccacacctggctttgggggctgtgaaaaatatctctctaaacatc
tccatctccaaccttggagacgacgcctatgatgccaacgtgtcctttaatgtctccagg
gaacttttcttcatcaacatgtggcagaaggaggagatgggcatttcctgtgagctgctg
gaatcagacttcctcaagtgcagtgtgggatttcctttcatgaggtcaaagtctaagtat
gaattcagtgtcatctttgatacaagccacctgtctggggaagaggaaattctcagcttc
atcgtgactgctcagagtggcaacttggagcgctctgaagccctgcatgacaacactctc
acactgacagtgcccctggtgcatgaagtggacacgtccatcactggaattgtgtcccca
acctccttcgtgtatggcgagtctgtggacgcatccaacttcattcagctggatgaccag
gagtgtcatttccaaccagtcaacattactctccaggtctacaacatgggtcccagcacc
cttcctgggtcatctgtcagcatctccttccccagccggctgtcacctggtggcgcagag
atgtttcaggtccaggacatggtggtgagccaagagaagggtaactgctctctacaaaga
aacccgaccccctgcatcatccctcaagaacaagagaacatcttccacaccatatttgct
ttcttctccaagtctggaagaaaagtgttggactgtgaaaagccagggagcttctgccta
acgttgcactgcaaccttagtgctcttccgaaagaggagagccgcaccatcaacctatac
atgctactgaacacagagatactgaagaaggacagctcctctgtcatccagttcatggct
cgagccaaggtgaaggtggagcctgccctgagagtggtggagatagctaacgggaaccca
gaagagactctggtggtcttcgaggccttgcacaatctggaaccccgtggctacgttgtg
gggtggatcatcgccatcagtttgctggtggggatcctcatttttctgctgctggctgtg
ctcctgtggaagatgggcttcttccgcagaaggtacaaagagatcattgaagctgagaaa
aaccggaaagagaatgaagatggttgggactgggtccagaaaaaccagtga

KEGG   Mus musculus (mouse): 109700Help
Entry
109700            CDS       T01002                                 

Gene name
Itga1, CD49A, E130012M19Rik, Vla1
Definition
(RefSeq) integrin alpha 1
  KO
K06480  integrin alpha 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109700 (Itga1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109700 (Itga1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109700 (Itga1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109700 (Itga1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109700 (Itga1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109700 (Itga1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    109700 (Itga1)
   05414 Dilated cardiomyopathy (DCM)
    109700 (Itga1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109700 (Itga1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    109700 (Itga1)
   04515 Cell adhesion molecules [BR:mmu04515]
    109700 (Itga1)
   04090 CD molecules [BR:mmu04090]
    109700 (Itga1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109700 (Itga1)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   109700 (Itga1)
CD molecules [BR:mmu04090]
 Proteins
  109700 (Itga1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 LYRIC VWA_3 Integrin_alpha Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 109700
NCBI-ProteinID: NP_001028400
MGI: 96599
Ensembl: ENSMUSG00000042284
UniProt: Q3V3R4 Q8BPT3
LinkDB All DBs
Position
13 D2.2; 13 64.61 cM
AA seq 1179 aa AA seqDB search
MVPRRPASLEVTVACIWLLTVILGVCISFNVDVKNSMSFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKARTGDVYKCPVGRERSMPCVKLDLPVNTSIPNVTEIKENMTFGSTLV
TNPKGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVQECSTQLDIVIVLDGS
NSIYPWESVTAFLNDLLKRMDIGPKQTQVGIVQYGANVTHEFNLNKYSSTEEVLVAANKI
GRRGGLQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNYRLKQVIQDCEDE
NIQRFSIAILGHYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKALGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQIVIPHNTT
FQTEPTKMNEPLASYLGYTVNSATIPGDVLYIAGQPRYNHTGQVVIYKMEDGDVNILQTL
SGEQIGSYFGSVLTTIDIDKDSYTDLLLVGAPMYMGTEKEEQGKVYVYAVNQTRFEYQMS
LEPIKQTCCSSLKDNSCTKENKNEPCGARFGTAVAAVKDLNVDGFNDVVIGAPLEDDHAG
AVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAAL
FWARDVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATMCFHVKLKSKEDSVYEADLQ
YRVTLDSLRQISRSFFSGTQERRIQRNLTVRESECIRHSFYMLDKHDFQDSVRVTLDFNL
TDPENGPVLDDALPNSVHGHIPFAKDCGNKERCVSDLTLDVSTTEKNLLIVRSQNDKFNV
SLTVKNKGDSAYNTRTVVQYSPNLIFSGIEEIQKDSCESNQNITCRVGYPFLRTGDVVNF
KIIFQFNTSHLSENAIIHLSATSDSEEPLESLYDNEVNISIPVKYEVGLQFYSSASEHHI
SVAANETVPELINSTKDIGDEINVFYTIRKRGHFPMPELRLAISFPNLTSDGYPVLYPTG
WSSSDNVNCRPRSLEDPLGINSGKKMTISKSEVLKRGTIQDCSTCKIATITCHLLPSDVS
QVNVSLILWKPTFIKAHFSSLNLTIRGELQSENSSLTLSSSNRKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggtccccaggcgtcctgctagcctagaggtcactgtagcctgcatctggcttctcacc
gttatcctaggcgtctgcatctccttcaacgttgatgtcaaaaactccatgagcttcagt
ggtccagtggaggacatgtttggatacaccgttcaacagtatgaaaacgaagaaggcaaa
tgggttcttattggttctcctttagttggccaacccaaagcaagaactggagatgtctat
aagtgtccagttgggagagagagatcaatgccttgtgtgaagttggatttaccagttaac
acatcgattcctaatgtcacagaaataaaggaaaacatgacatttggatcaactttagtc
accaatccgaagggaggatttctggcatgtgggcccttgtatgcctatagatgtggacat
ttgcattatacgactggcatatgttctgatgtcagccctacatttcaagttgtgaactcg
ttcgcccctgtacaagaatgtagcacacagcttgacatagtcatcgtcctagatggctcc
aacagcatctacccctgggaaagtgtcactgcctttttaaacgaccttcttaagaggatg
gacattggccccaaacagacacaggttggaattgtacaatatggagcaaatgtaacacat
gagttcaacctcaataagtattcatccacagaagaggtcctggtggcagcaaacaaaata
ggccgcaggggtggtctccagacgatgacagcccttggaatagacacagccaggaaagag
gcattcactgaagctcggggggccagaaggggagtgaaaaaagtcatggttattgtgact
gatggagaatcgcatgacaactatcgcctgaaacaggtcatccaagactgtgaggatgaa
aacattcagcgattttccatagctatccttggccactataacagggggaacttaagcacc
gaaaaatttgtggaggagataaaatcaatcgcaagtgagcccaccgaaaagcacttcttc
aacgtctcagatgagttggccctggtcactattgttaaagctctgggagaaaggatattt
gctttggaagctacagctgaccagtcagcagcttcgtttgaaatggagatgtctcagacc
ggcttcagtgctcattattcacaggactgggtcatgcttggagctgttggagcctatgac
tggaacggaactgtggtcatgcagaaggctaaccagattgtcatccctcataacaccacc
tttcaaactgagcccaccaagatgaacgagcctcttgcttcttacttgggttacacagtg
aactctgccaccatcccgggagatgtgctctatatcgctgggcagcctcggtacaatcac
accggccaggtcgtcatctacaagatggaggatggggacgtcaacattctgcagacactc
agtggagagcagatcggatcctactttggtagcgtcttaaccacaattgacatcgacaaa
gattcttacactgatctgcttctcgtcggggctcccatgtatatggggacagagaaagag
gaacagggcaaggtgtacgtgtacgctgtgaatcagacgaggtttgaatatcaaatgagc
ctggaaccaattaagcagacctgctgttcatccctgaaggataattcatgcacaaaagaa
aacaagaatgagccctgtggggcccgttttggaacagcagttgctgctgtaaaagacctc
aacgtggatggctttaatgacgtcgtgattggagctcccctggaagacgaccacgcagga
gctgtgtacatttatcatggcagtggcaagaccataaggaaagagtatgcgcaacgcatt
ccctcaggtggggatgggaagacgctgaaattttttggccagtctatccacggagagatg
gatttaaatggcgatggtctgactgacgtgaccattggaggccttggaggagctgccctc
ttctgggccagagatgtggctgtagttaaagtgaccatgaattttgaacccaacaaagtg
aatattcaaaagaaaaactgccgtgtggagggcaaagaaacagtatgcataaatgctaca
atgtgttttcatgtgaaattgaagtctaaagaagactcagtttacgaggctgatctgcag
taccgtgtcacccttgattcgctgaggcagatatcacggagctttttttctggaactcag
gaaaggaggattcaaagaaacctcaccgttcgagaatccgaatgcatcaggcactccttc
tacatgttggataagcacgactttcaggactccgtgagagtgactttggattttaacctc
actgatccagaaaatgggcccgtgctcgatgacgctctgccaaactcagtccatggacat
attccttttgccaaagactgtgggaacaaggaaagatgcgtttcagacctcaccctggat
gtgtccacaacagaaaagaacctgctgattgtcagatcccagaatgacaagttcaatgtc
agcctcaccgtcaaaaacaagggagacagtgcgtacaacacccggacagtggttcagtat
tctccaaatctgattttttcaggaattgaggagatccaaaaagatagctgcgaatccaat
caaaatatcacgtgtagagttggatatcctttcctgaggacaggagacgtggttaacttc
aaaataatattccagtttaatacatcacatctctcagaaaatgcaattattcatttaagt
gcaacaagtgacagtgaagagcccctggaatctctttacgataatgaagtaaatatttcc
atccccgtaaaatatgaagtcggactgcagttttacagttctgcgagtgaacaccacatt
tcagttgctgccaatgagactgttcctgagctgattaattccaccaaggacattggggat
gaaattaatgtcttctacacgattagaaaaagagggcatttcccaatgccagaacttcgg
ctggcaatttcatttcccaatctgacgtcagatggctatcctgtactgtacccaactgga
tggtcatcttctgataatgtaaactgcagacctcgaagccttgaggaccctttgggtatc
aactctgggaagaaaatgacaatatcaaagtctgaggttctcaaaagaggcacaatccag
gactgcagtacctgcaagattgctaccatcacgtgtcatctccttccctcggatgtgagt
caagtgaatgtctcactcatcttgtggaaaccaactttcataaaagcacatttttccagc
ttaaatcttaccatacggggagaacttcagagtgaaaactcatcgctgactttaagcagc
agcaaccggaaacgagagctggctattcagatatccaaagacgggctcccaggccgagtg
ccgctgtgggttatcctcctgagcgcctttgcgggactcctgctgttaatgctgcttata
ttagctctgtggaagattggattcttcaaaaggccactaaagaagaaaatggagaaatga

KEGG   Mus musculus (mouse): 16398Help
Entry
16398             CDS       T01002                                 

Gene name
Itga2, CD49B, DX5, GPIa
Definition
(RefSeq) integrin alpha 2
  KO
K06481  integrin alpha 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16398 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16398 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16398 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16398 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16398 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16398 (Itga2)
   04611 Platelet activation
    16398 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16398 (Itga2)
   05205 Proteoglycans in cancer
    16398 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16398 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16398 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16398 (Itga2)
   05414 Dilated cardiomyopathy (DCM)
    16398 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16398 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16398 (Itga2)
   04515 Cell adhesion molecules [BR:mmu04515]
    16398 (Itga2)
   04090 CD molecules [BR:mmu04090]
    16398 (Itga2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   16398 (Itga2)
  Exosomal proteins of bladder cancer cells
   16398 (Itga2)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16398 (Itga2)
CD molecules [BR:mmu04090]
 Proteins
  16398 (Itga2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 16398
NCBI-ProteinID: NP_032422
MGI: 96600
Ensembl: ENSMUSG00000015533
UniProt: Q62469
LinkDB All DBs
Position
13 D2.2; 13 64.61 cM
AA seq 1178 aa AA seqDB search
MGPGQAGGALLLRLLMLVQGILNCLAYNVGLPGAKIFSGPSSEQFGYSVQQLTNPQGNWL
LVGSPWSGFPENRMGDVYKCPVDLPTATCEKLNLQNSASISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQFLTSFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLVKFVTGLDIGPKKTQVALIQYANEPRIIFNLNDFETKEDMVQATSETR
QHGGDLTNTFRAIEFARDYAYSQTSGGRPGATKVMVVVTDGESHDGSKLKTVIQQCNDDE
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEQIFS
IEGTVQGGDNFQMEMAQVGFSADYAPQNDILMLGAVGAFDWSGTLVQETSHKPVIFPKQA
FDQVLQDRNHSSFLGYSVAAISTEDGVHFVAGAPRANYTGQIVLYSVNKQGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPTYMNDLKKEEGKVYLFTITKGILNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSNGAFRRHLQFFGRSLDGYGDLNGDSITDVSIGALGQVIQLWSQSIADVAIEALFTP
DKITLLNKDAKITLKLCFRAEFRPAGQNNQVAILFNMTLDADGHSSRVTSRGVFRENSER
FLQKNMVVNEVQKCSEHHISIQKPSDVVNPLDLRVDISLENPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVQQLPAIQTQSFIVSNQNKRLTFSVILKNRGESAYNTVVLA
EFSENLFFASFSMPVDGTEVTCEVGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFQAFSESQETNKADNSVSLTIPLLYDAELHLTRSTNINFYEISSDENAPSVIKS
VEDIGPKFIFSLKVTAGSAPVSMALVTIHIPQYTKEKNPLLYLTGIQTDQAGDISCTAEI
NPLKLPHTAPSVSFKNENFRHTKELDCRTTSCSNITCWLKDLHMKAEYFINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMTAGLWKLGFFKRQYKKMGQNPDEMDETTELNS
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgggacaggcagggggcgcgctcctgctgcggctgctaatgctagttcaaggt
attttgaattgtctggcgtataatgttggcctcccaggagcgaaaatattttccgggcct
tcaagtgaacagtttgggtattcagtacagcagcttacgaacccacaaggcaactggcta
ctggttggttcaccgtggagtggcttccctgagaaccgaatgggagatgtgtacaagtgc
cctgtggacctacccactgccacctgtgaaaagctgaatctgcaaaattcagcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggattgaccctcaccaggaatccg
gggaccggaggctttctaacctgtggtcctctctgggcacatcagtgtggaaatcagtat
tatgcaactgggatctgttctgatgttagtccagactttcagttcttgaccagcttttca
cctgcagttcaggcttgcccttccctcgtggatgttgtagttgtatgtgatgaatcaaac
agtatttatccttgggaagcagtaaagaactttttggtaaagtttgtgacaggcctggat
ataggacctaaaaagacacaggtggcgttaattcaatatgccaatgagccgagaattata
tttaacttgaacgatttcgaaaccaaagaggatatggtccaggccacatctgagacgcgc
caacatggtggggacctcacaaacaccttcagagctatcgaattcgcaagagactacgct
tattcacagacttctggcgggcgcccgggtgctacaaaagtcatggtagttgtgaccgat
ggcgagtcccatgatgggtcgaagctgaaaactgtgatccagcaatgcaatgatgacgag
atactgaggttcggcatagcagttcttgggtatttaaacagaaatgctcttgatactaaa
aatttaatcaaagaaataaaagcaattgctagtactccaaccgagagatactttttcaat
gtggccgacgaagcggctcttctggagaaggctggaactctaggggagcaaatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagttggattc
agtgcagattacgctcctcaaaatgatattctgatgttaggtgcagtgggggcttttgac
tggagtggaactcttgtccaggagacatctcacaagcccgtgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaaccacagttcgtttttaggttactctgtggctgca
atttctactgaagacggtgtccattttgttgctggtgctcctcgagcaaattatactggc
cagatagtgttgtacagcgttaacaagcaaggcaatgtgaccgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgctcagttgatgtagataaagac
accattacagacgtgctcctggtaggtgctcctacatacatgaacgacctcaagaaagaa
gagggaaaagtctacctatttaccatcacaaagggcatcttgaatcagcaccagtttctt
gaagggccagaaggcactggaaatgctcggtttggttcagcaattgcagccctgtcagac
atcaacatggatggctttaatgatgtgattgtcggttcacctgtagagaatgagaactct
ggagctgtgtacatttacaatggtcaccagggtaccattcgcaccaagtactcccagaaa
atccttgggtccaatggagcctttaggagacatctccagttctttggaaggtccctggat
ggctatggtgatttaaatggggattccatcactgatgtatccattggtgctttggggcaa
gtgattcaactctggtcacaaagcattgctgacgtggccatagaagctttgttcactcca
gacaaaatcactttgctcaacaaggatgctaagataaccctaaagctctgcttcagagca
gagtttagacctgctgggcaaaacaatcaagtagccatcctgtttaacatgacgcttgat
gcggacggacattcatccagggtaacctccaggggggtgttcagagaaaacagtgagcga
ttcttgcagaagaatatggtggtaaacgaagtgcagaagtgttctgagcaccacattagc
atacagaagccctctgatgttgtcaaccctttggatctgcgtgtggacatcagtttggaa
aacccaggcactagccctgccctcgaagcctattctgaaactgtcaaagtcttcagtatc
cctttctataaggagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
caacagctgccagccattcaaactcaatcctttattgtcagtaaccaaaacaagaggtta
acattttcagtcatcctgaaaaacagaggggaaagtgcatacaacactgtggtcctggcc
gagttttctgagaacttgttttttgcttctttctccatgccggtcgatggaacagaagta
acatgtgaggttggttcatcgcagaaatctgttacctgtgatgtgggataccctgcctta
aagagtgaacagcaggtgacttttaccattaacttcgactttaatcttcaaaacctccag
aaccaggcggccatcaatttccaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagtctcacgattcctctcctgtatgatgccgaacttcacttaacccgatcc
accaacatcaacttctatgagatctcttcggatgagaacgctccttctgtcatcaagagt
gtcgaagatattggtcctaaattcatcttctccctcaaggtaacagccggaagtgcccca
gtgagcatggcattggtgactatccacattcctcagtacaccaaggaaaagaacccactc
ctgtatctgactgggatacaaacagaccaggctggcgacatcagctgcacagcagaaata
aatccactcaagctaccacacaccgccccttctgtatctttcaagaatgaaaacttccgg
catacgaaagaattggactgcagaaccacttcctgcagtaacatcacctgctggctgaaa
gaccttcacatgaaagcagagtacttcatcaatgtgacaaccagagtttggaacaggacc
tttgctgcttcgactttccagactgtgcagctgacagcagcggcagagatcgatacacat
aaccctcagctcttcgtgattgaggaaaatgctgtcacgattcccctcatgataatgaaa
cccacggagaaagcagaagtaccgacaggggttatcataggcagcataattgcgggaatc
cttttgctgttggctatgactgcaggtttgtggaagctcggcttcttcaaaagacaatat
aagaaaatgggccaaaatccagatgagatggatgagaccacagaactcaacagctaa

KEGG   Mus musculus (mouse): 16399Help
Entry
16399             CDS       T01002                                 

Gene name
Itga2b, AI172977, CD41, CD41B, GpIIb, alphaIIb
Definition
(RefSeq) integrin alpha 2b
  KO
K06476  integrin alpha 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16399 (Itga2b)
   04151 PI3K-Akt signaling pathway
    16399 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16399 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16399 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16399 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16399 (Itga2b)
   04611 Platelet activation
    16399 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16399 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16399 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16399 (Itga2b)
   05410 Hypertrophic cardiomyopathy (HCM)
    16399 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16399 (Itga2b)
   05414 Dilated cardiomyopathy (DCM)
    16399 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16399 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    16399 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16399 (Itga2b)
   04515 Cell adhesion molecules [BR:mmu04515]
    16399 (Itga2b)
   04090 CD molecules [BR:mmu04090]
    16399 (Itga2b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16399 (Itga2b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16399 (Itga2b)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16399 (Itga2b)
CD molecules [BR:mmu04090]
 Proteins
  16399 (Itga2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 16399
NCBI-ProteinID: NP_034705
MGI: 96601
Ensembl: ENSMUSG00000034664
Vega: OTTMUSG00000002857
UniProt: Q9QUM0
LinkDB All DBs
Position
11 D; 11 66.29 cM
AA seq 1033 aa AA seqDB search
MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGPNGSHFGFSVDFHKDK
HGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLRDETRNLGFQIFQTFKT
GQGLGASVVSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFLAQLQSGGRAEYSPCRAN
TMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLARVPIENIISSYRPG
TLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEIL
DSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYL
FLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQL
DLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICHTTGAFLRDEADFRDKLSPIVLSLN
VSLPPEETGGAPAVVLHGETHVQEQTRIILDCGEDDLCVPQLRLTATAGDSPLLIGADNV
LELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELG
NPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVMLPVAIQAEATVEL
RGNSFPASLVVAAEEGDREQEDLDRWVSRLEHTYELHNIGPGTVNGLRLLIHIPGQSQPS
DLLYILDVQPQGGLLCSTQPSPKVDWKLSTPSPSSIRPVHHQRERRQAFLQGPKPGQQDP
VLVSCDGSASCTVVECELREMVRGQRAMVTVQVMLGLSSLRQRPQEQFVLQSHAWFNVSS
LPYSVPVVSLPSGQARVQTQLLRALEERAIPVWWVLVGVLGGLLLLTLLVLAMWKAGFFK
RNRPPLEEDEEEE
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcctcctgcgcatggcattccctgtggcttctgcagtggacaccactgttc
ttgggtcctagtgctgttcctccagtctgggccttgaacctggactctgagaagttctcc
gtctatgcaggtcccaatggcagccactttggcttctcagtggactttcataaggacaaa
catggaagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaagtcaagaggag
actggagccgtattcctgtgcccctggaaggccaatggtggcaagtgcaacccgttgctc
ttcgacctcagggatgagacacgaaacctaggcttccaaattttccaaaccttcaagacc
gggcaaggacttggggcgtcggtcgtcagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctggaaaagcgcgatgaggcagagaagactccggtaggaggc
tgcttcttggctcagctccaaagcgggggccgcgcagagtactcgccctgtcgcgccaac
accatgagctccgtttacgcagagagttttcgcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggagcccctggaggctacttt
tttttaggtctcctggctcgcgttccaattgagaacatcatctccagctaccgcccgggt
acccttttgtggcatgtttccaaccagcgcttcacctacgacaacagcaacccagtgttt
ttcgatggttaccggggatattcggtagccgtgggcgagtttgatggggatccgagcact
acagagtacgtatcgggtgcccccacttggagctggaccttgggagcggtggaaattttg
gactcctactaccagcccctgcaccggcttcatggagaacagatggcttcatatttcggg
cactcggtggcagtcactgacgtcaacggggacgggaggcatgacctactggtgggggct
ccattgtatatggagagcagggcagaccgcaagctggccgaggtgggccgcgtttatttg
tttctgcagcctaagggcccccaagctctgagcacacccactctcctgctgactggcacc
cagctctatgggagatttggatctgccattgcacccctgggtgacctcaaccgagacggc
tataatgatattgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattcctgggtcagagtgaagggctgagtccacgcccctcccaggttctggacagcccc
ttccccacaggctctggctttggcttctcccttcgtggtgctgtagacatcgatgacaat
ggatacccagacctgattgtgggagcatatggagctagcaaggtggctgtgtacagagct
cagcctgtggtgatggccactgtccaactgatggttcaagactccctgaatccaacactg
aagaactgtgtcctggatcagaccaagacaccagtcagctgcttcaacatccagatgtgt
gtgggagccacaggacacaacattcctcagaagctgcatctaaaggcagagctgcagctg
gacttacagaagccccgtcagggccgccgggtgctcctgctggcatcccaacaggcgagc
ctcaccctgagcctggacctgggcggaagagacaagcctatctgccacaccacgggggcc
ttccttcgggatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaac
gtgtcgctgcccccagaagagactggaggagcccctgccgtggtattgcatggagaaacc
catgtccaggagcagacacggatcatcctggattgtggggaagacgacctgtgtgtgcca
cagctccggctcacagctactgcgggggactccccactcctaatcggtgctgacaatgtg
ttggagctgaagattgaagcagccaatgatggtgagggagcctatgaagcggagctggct
gtgcatctgcctccaggtgcccactacatgcgggctctcagcaacattgagggctttgag
aggcttgtctgcactcagaagaaagagaatgagtccagggtggccctctgtgagctgggc
aaccccatgaaaaaggacacccggataggaatcacaatgctggtgagtgtggagaacctg
gaagaagctggcgagtccgtgtccttccagctgcaggtcaggagcaagaacagccagaat
ccaaacagtaaggtcgtgatgttgcctgtggcaatccaagctgaagccacagtggagctt
cgagggaattccttccctgcctccctggtggtggcagcagaagaaggtgacagggagcag
gaagacttggacagatgggtctccaggctggagcacacctatgagctccacaacattggc
cctggcactgtgaatggcctcagacttctcatccacattcctggccagtcccagccctcg
gatctgctctacatcctggatgtgcagccgcagggaggtctcctttgctccacacagcca
tctcccaaggtggactggaaactatccacgcccagcccttcttccattcgccccgtccat
caccagcgtgagcgcagacaggcattcctgcaggggcccaagccagggcagcaggaccca
gttctggtgagctgcgacggctcagcgtcctgtacggtggtggagtgtgagctgcgggag
atggtgcgcgggcagcgggccatggttactgtgcaggtcatgctggggctgtccagcctc
cgccagaggccgcaggagcagtttgtgctgcagtcgcacgcctggttcaacgtctcctcc
ctaccttactcggtgccggtggtcagcttgcccagtgggcaagctcgggtgcagacacag
ctgcttcgggccttggaggagagggccattcctgtctggtgggtgctggtgggcgtgctg
ggcggtctgctgctgctgaccctgctagttttggccatgtggaaggctggcttcttcaag
cggaatcgaccgcctctggaggaagatgaagaggaagagtga

KEGG   Mus musculus (mouse): 16400Help
Entry
16400             CDS       T01002                                 

Gene name
Itga3, AA407068, CD49C, GAPB3
Definition
(RefSeq) integrin alpha 3
  KO
K06482  integrin alpha 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16400 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16400 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16400 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16400 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16400 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16400 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16400 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16400 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16400 (Itga3)
   05414 Dilated cardiomyopathy (DCM)
    16400 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16400 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16400 (Itga3)
   04515 Cell adhesion molecules [BR:mmu04515]
    16400 (Itga3)
   04090 CD molecules [BR:mmu04090]
    16400 (Itga3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16400 (Itga3)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16400 (Itga3)
CD molecules [BR:mmu04090]
 Proteins
  16400 (Itga3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Motif
Other DBs
NCBI-GeneID: 16400
NCBI-ProteinID: NP_038593
MGI: 96602
Ensembl: ENSMUSG00000001507
Vega: OTTMUSG00000001616
UniProt: Q62470
LinkDB All DBs
Position
11 D; 11 59.01 cM
AA seq 1053 aa AA seqDB search
MGPGPCRVPRAPGWLLRALALMVAACGRVAFAFNLDTRFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAPRHQHMGAVFLLKQESGGDLQRKQVLK
GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGASFPDQPSL
LLHGPSRSAFGISIASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLRQPQQIIHG
EKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAV
LDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVF
HGFFSMPETHCQTLELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDAYPVLNQ
AQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTN
SPSSQRAGEDAHEALLTLEVPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLI
AFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLMNHRLQSFFGGT
VMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITI
HSNGSWPCQPSGNLVNPLNLTLSDPGVTPLSPQRRRRQLDPGGDQSSPPVTLAAAKKAKS
ETVLTCSNGRARCVWLECPLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFL
RTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGF
FKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgggccccggcccctgccgcgtgccccgcgcccctggctggctgctccgcgctctggcc
ttgatggtggcggcttgcggccgggtcgccttcgccttcaacctggacacccgattcctg
gtggtgaaggaggcggtgaaccccggtagcctcttcggctactcggtcgccctccatcgg
cagactgagcgacaacagcgctacctccttctggccggggctccccgggacctcgctgtg
ggtgatgactataccaaccggactggtgctgtgtacctgtgtcccctcacggcccacaag
gacgactgtgaacggatggacatttcagagaaaagtgaccctgaccatcacattattgag
gatatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctagaagaccagcggcgcatggtgggc
aagtgctatgtgcgtggcaatgacctacagctcgaccccggcgatgactggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagaccggcatgtgccagctgggc
accagcggcggcttcacccagaacaccgtatacttcggtgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatctgaatatagctacagg
ggctcagaggagcaaggaaacctttatattgggtacacggtgcaggtaggcaacgccatc
ctacatcccacggacatcatcactgttgtgacgggtgccccacggcaccaacatatgggc
gctgtcttcttgctgaagcaagagtcaggtggagacctgcagaggaagcaggtgctgaag
ggcacgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgat
gggtggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtaggg
ggtgccgtctatgtcttcatgaaccaggcgggcgcatccttccctgatcaaccttccctc
ctgcttcacggccccagccgctctgcctttggcatctctatagccagcatcggtgacatc
aaccaggatggattccaggacatcgctgtgggagccccatttgagggcttgggcaaagtc
tacatctaccacagcagctccggggggctcctcaggcagccccagcagataatccatgga
gagaaactcggactgccaggcttggccaccttcggctactccctgagcgggaagatggat
gtggatgaaaacctttacccagacctgctagtagggagcctgtcggaccacatcgtgctg
ctgcgggcccggcctgtcatcaatatcctccataggaccttggtggccaggccagctgtg
ttggaccctgcgctttgtacagctacctcctgtgttcaggtggagctgtgttttgcctac
aaccagagcgctgggaaccccaactacaggcggaacatcaccctggcttacacactggag
gctgacagggaccgacgcccacccaggctccgatttgcccgcagccagtcatctgtcttc
cacggcttcttctccatgccagagacacattgccagacactggagttactgctgatggac
aatgttcgcgataaactccgtcctatcgtcattgccatgaactactccttacctctgcgc
atgcctgatcgcctcaagctcggcttgcggtctctggatgcctacccagtcctcaaccag
gcacaggctatggagaatcacactgaggtccacttccagaaagagtgcgggccagacaac
aagtgcgacagcaacctgcagatgcgagcagccttcctgtctgagcagctgcagcctcta
agcaggctccagtacagcagagacactaagaaactgtttttgagcatcaatgtgaccaat
tcaccgagcagccaacgggctggggaagatgcgcatgaggcattgctcaccctagaggtg
ccatccgccctgctactgtcctccgtgcgcccgtctgggacctgccaagctaataacgag
accatcctgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatt
gcctttgaggtcatcggggtaacgttgcacacgagggacctcccagtacttcttcagctg
tccacgtcgagtcaccaggacaacttgcagcccgtactcctgactttgcaggtggactac
accctccaggcctcgctcagcttaatgaatcatcggttgcagagcttctttggtggcaca
gtgatgggtgaggctgccatgaaaactgcggaggatgtgggaagtcccctgaaatatgaa
ttccaggtgagcccagtgggagatgggctggcagccttgggcacactggttctaggtctg
gagtggccctatgaagttaccaatggcaagtggctgctgtaccccacggagatcaccatc
catagcaatggttcctggccctgccagccgtctggaaaccttgtcaaccctctcaacctt
actctctctgaccctggagtcacaccactgtcgccacagcgccgccggcggcaactggat
ccagggggagaccagagttccccgcctgtcacactagctgctgccaaaaaagccaagtct
gagactgtgttgacctgctccaatggccgtgcccgctgtgtgtggctggagtgccccctt
ccagacacctccaacattaccaatgtgaccgtgaaagcacgggtgtggaacagcaccttc
attgaggactacaaagactttgacagagtcagggtagatggctgggctaccctgttcctg
agaaccagcatccctaccatcaacatggagaacaagaccacatggttctctgtggacatt
gactcagagctggtggaggagctgccggctgagattgagctgtggttggtgcttgtggcc
gtgggtgctgggttgctgctgctggggctcatcatcctcctcttgtggaagtgcggcttc
ttcaagcgagcccgcactcgtgccctgtatgaagctaagaggcagaaggctgagatgaag
agccagccgtcagagacagaaaggctgaccgacgactactga

KEGG   Mus musculus (mouse): 16401Help
Entry
16401             CDS       T01002                                 

Gene name
Itga4, CD49D, Itga4B
Definition
(RefSeq) integrin alpha 4
  KO
K06483  integrin alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04640  Hematopoietic cell lineage
mmu04670  Leukocyte transendothelial migration
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16401 (Itga4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16401 (Itga4)
   04514 Cell adhesion molecules (CAMs)
    16401 (Itga4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16401 (Itga4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16401 (Itga4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16401 (Itga4)
   04670 Leukocyte transendothelial migration
    16401 (Itga4)
   04672 Intestinal immune network for IgA production
    16401 (Itga4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16401 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16401 (Itga4)
   05414 Dilated cardiomyopathy (DCM)
    16401 (Itga4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16401 (Itga4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16401 (Itga4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16401 (Itga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16401 (Itga4)
   04515 Cell adhesion molecules [BR:mmu04515]
    16401 (Itga4)
   04090 CD molecules [BR:mmu04090]
    16401 (Itga4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16401 (Itga4)
  Exosomal proteins of other cancer cells
   16401 (Itga4)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16401 (Itga4)
CD molecules [BR:mmu04090]
 Proteins
  16401 (Itga4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF1945
Motif
Other DBs
NCBI-GeneID: 16401
NCBI-ProteinID: NP_034706
MGI: 96603
Ensembl: ENSMUSG00000027009
Vega: OTTMUSG00000013313
UniProt: Q00651 Q792F9 Q8BQ25
LinkDB All DBs
Position
2 C3; 2 47.38 cM
AA seq 1032 aa AA seqDB search
MAAEARCRPRSRGIALREAVMLLLYFGVPTGHSYNLDPENALLYQGPSGTLFGYSVVLHS
HGSKRWLIVGAPTASWLSNASVVNPGAIYRCGIRKNPNQTCEQLQLGSPSGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYMKSDNKLPTGICYVMPSDLRTELSKRM
APCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVD
RQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIDENELNIVYEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEMERVLVG
SDKYAARFGESIANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQRIEG
QQISKSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCTENGLPSVCMHLTLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFFSNGT
SDVITGSIRVSSSGEKCRTHQAFMRKDVRDILTPIHVEATYHLGHHVITKRNTEEFPPLQ
PILQQKKEKDVIRKMINFARFCAYENCSADLQVSAKVGFLKPYENKTYLAVGSMKTIMLN
VSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCEVTESSGIVKLACSLGYIYVDR
LSRIDISFLLDVSSLSRAHEDLSISVHASCENEGELDQVRDNRVTLTIPLRYEVMLTVHG
LVNPTSFVYGSSEENEPETCMAEKLNLTFHVINTGISMAPNVSVKIMVPNSFLPQDDKLF
NVLDVQTTTGQCHFKHYGRECTFAQQKGIAGTLTDIVKFLSKTDKRLLYCMKADQHCLDF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIKATAFPEPHPKVIELNKDENVA
HVFLEGLHHQRPKRHFTIIIITISLLLGLIVLLLISCVMWKAGFFKRQYKSILQEENRRD
SWSYVNSKSNDD
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaagcgaggtgcagaccgaggtcccgagggatcgccctccgggaagcggtg
atgctgttgttgtacttcggggtgccaaccgggcactcctacaacctggacccggagaat
gcactgctgtaccagggcccctccggcacgctgtttggctactcggtggtgctgcacagc
cacgggtcgaagcgctggctcatcgtgggggctcccactgccagctggctctctaatgcc
tcagtggtcaatcctggggcgatttacagatgcgggatcagaaagaatccaaaccagacc
tgcgaacagctccagctgggtagccccagtggagagccttgtgggaagacatgcctggag
gagagggataaccagtggctgggggtcaccctttccagacagcctggagaaaatggctct
atcgtgacttgtgggcacaggtggaaaaatattttttacatgaagagcgataacaaactc
cccactggcatttgctacgtcatgccttctgatttgcggacagaactgagtaaaaggatg
gccccgtgttacaaagattatacgagaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacacaggatttaattgtgatgggggccccgggatcatcgtac
tggactggcaccgtctttgtctacaatataactacaaaccaatacaaagcatttgtagac
agacagaaccaagtaaaatttggaagctacttaggctactcagttggagctggacatttt
cgaagtccacatactaccgaagtcgtgggaggagcccctcaacacgaacagataggaaaa
gcatatatatttagcattgatgaaaacgaactgaacatcgtatatgaaatgaaaggtaaa
aagcttggctcatactttggagcttctgtctgcgctgtggacctcaatgcagatggcttc
tcagatctccttgttggagctcccatgcagagcaccatcagggaggaaggaagagtattc
gtgtacatcaactctggcatgggagctgtgatggttgaaatggaaagggtccttgtcgga
agtgacaaatatgctgcaagatttggggagtctatagcgaatcttggcgacattgacaat
gacggctttgaagatattgctattggtgcaccacaagaagacgacttgagaggtgctgtc
tacatttacaatggccgagtcgatggaatctcctccacctactcacagagaattgaagga
cagcaaatcagcaaatcattaaggatgtttggacaatctatctcaggacaaattgatgca
gacaacaatggatatgttgatgtagccgttggtgcatttcaatctgattctgcagtgttg
ctaaggacaaggcctgtagtgattgttgaagcatctttaagccatcctgagtctgtaaat
aggacaaagtttgactgtactgaaaatggacttccatctgtgtgcatgcatcttacactg
tgtttctcatataaaggcaaagaggtcccaggctacatcgttttgttttacaatgtgagc
ttggatgtgcacaggaaggcagagtctccgtcaagattttatttcttctctaatgggact
tctgacgtgattacaggaagcatacgagtttcaagcagtggagagaaatgtaggacacac
caggcattcatgcggaaagacgtgcgagacatccttacccccattcatgtagaggccaca
taccaccttgggcatcatgtgatcaccaaacgaaacactgaggaatttccaccactccag
ccgatccttcagcagaagaaagaaaaagacgttattagaaaaatgataaactttgcaagg
ttttgtgcctatgaaaattgctctgctgatctccaagtttctgcaaaagttggatttttg
aagccatatgaaaataaaacctatcttgctgttgggagcatgaagaccataatgctaaac
gtgtccttgttcaacgctggcgatgatgcttacgaaaccactctgaatgtccaactcccc
acaggcctttatttcattaagatcttagacctggaagagaaacaaataaactgcgaagtg
actgagagctcaggcatagtgaagcttgcctgcagcctaggttacatatatgtggatcgc
ctctcaaggatagacattagctttctcctggatgtgagctcactcagcagggcacatgag
gacctcagcatcagtgtgcatgcctcctgtgaaaacgagggcgaattggaccaagtgagg
gacaacagagtgaccttaacgatacctctaaggtatgaggttatgctgactgttcatggg
cttgtgaacccaacttcatttgtgtatggatctagcgaagaaaacgagccagaaacatgc
atggccgagaagctgaacctcactttccatgttataaacactgggattagcatggctcca
aatgttagtgtgaaaataatggtaccaaattcttttctccctcaagatgataagttgttc
aacgttttggatgtccagacaactacagggcaatgccattttaaacactatggaagagag
tgtacatttgcacagcaaaaaggcatagcggggacgttgaccgatatagtcaaattccta
tcaaagactgataagagactcctgtattgcatgaaagctgatcaacactgtttagatttc
ttatgcaatttcggaaaaatggaaagtgggaaggaagccagcgttcatattcagctggag
ggcaggccatccatcttggaaatggatgagacctcatcactcaagtttgaaataaaagca
acagcttttccagagccacacccaaaagttattgaactaaataaagatgagaacgtggcc
catgttttcttggaagggctccatcatcaaagacccaaacgacatttcaccatcattatt
attaccatcagcttgctacttggacttattgtacttttattaatttcatgtgttatgtgg
aaggctggattctttaaaagacagtacaaatctatcctacaagaagaaaacaggagagac
agctggagttatgtcaacagcaaaagcaatgatgactga

KEGG   Mus musculus (mouse): 16402Help
Entry
16402             CDS       T01002                                 

Gene name
Itga5, Cd49e, Fnra, VLA5
Definition
(RefSeq) integrin alpha 5 (fibronectin receptor alpha)
  KO
K06484  integrin alpha 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16402 (Itga5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16402 (Itga5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16402 (Itga5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16402 (Itga5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16402 (Itga5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16402 (Itga5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    16402 (Itga5)
   05205 Proteoglycans in cancer
    16402 (Itga5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16402 (Itga5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16402 (Itga5)
   05414 Dilated cardiomyopathy (DCM)
    16402 (Itga5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16402 (Itga5)
   05133 Pertussis
    16402 (Itga5)
   05100 Bacterial invasion of epithelial cells
    16402 (Itga5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    16402 (Itga5)
   05165 Human papillomavirus infection
    16402 (Itga5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16402 (Itga5)
   04515 Cell adhesion molecules [BR:mmu04515]
    16402 (Itga5)
   04090 CD molecules [BR:mmu04090]
    16402 (Itga5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16402 (Itga5)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16402 (Itga5)
CD molecules [BR:mmu04090]
 Proteins
  16402 (Itga5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 16402
NCBI-ProteinID: NP_034707
MGI: 96604
Ensembl: ENSMUSG00000000555
Vega: OTTMUSG00000062577
UniProt: P11688 Q80YP5
LinkDB All DBs
Position
15 F3; 15 58.9 cM
AA seq 1053 aa AA seqDB search
MGSWTPRSPRSPLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPG
SLFGFSVEFYRPGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKG
SRILESSLYSAKGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCY
LSTENFTRILEYAPCRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSAT
QEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGN
LTYGYVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADG
RPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYNDVAIGAPFG
GEAQQGVVFIFPGGPGGLSTKPSQVLQPLWAAGRTPDFFGSALRGGRDLDGNGYPDLIVG
SFGVDKALVYRGRPIISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVP
NSIGFEVELQLDWQKQKGGVRRALFLTSKQATLTQTLLIQNGAREDCREMKIYLRNESEF
RDKLSPIHIALNFSLDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQL
DVYGEKKHVYLGDKNALNLTFHAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLS
CDYFAVNQSRQLVCDLGNPMKAGTSLWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQS
NVVSFPLSVEAQAQVSLNGVSKPEAVIFPVSDWNPQDQPQKEEDLGPAVHHVYELINQGP
SSISQGVLELSCPQALEGQQLLYVTKVTGLSNCTSNYTPNSQGLELDPETSPHHLQKREA
PGRSSTASGTQVLKCPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQREYQPFSLQ
CEAVYEALKMPYQILPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLL
IYVLYKLGFFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggggagctggacgccacggtcgcctcgatctcctctccacgcggtgctgctgcgctgg
gggccccgacgcctaccgccgctgctgcctctgctgctgctactgtggccgccaccactc
caggttgggggcttcaacctagacgcggaggccccggcggtgctctccgggccccccggc
tccctttttggcttctccgtggagttttaccggccgggaagggacggagtcagtgtgctg
gttggggcacccaaggctaacactagccagccaggtgtactgcaaggtggtgctgtctat
gtgtgtccctggggcaccagtcctatccagtgcaccaccattcaatttgacagcaaaggc
tcccggattctggagtcctcactgtacagtgccaagggagaggagcctgtggagtacaag
tccttgcagtggttcggagcaacagttcgggcccatggctcctccatcttggcatgtgct
ccactgtatagctggcgcacagaaaaggacccacagaatgacccagtgggcacctgctac
ctctccacagaaaacttcacccggattctggagtacgcaccttgccgctcagattttggc
agtgcagcagggcagggctactgccaagggggcttcagtgctgagttcaccaagactggc
cgtgtggtcctgggtggacctggaagctacttctggcaaggccagatcctgtccgccact
caagagcagatctcggagtcctattacccagagtatctcatcaaccctgttcaggggcag
ctgcagacccgccaggccagctccgtctatgatgacagctacttgggatactctgtggct
gtgggtgaattcagtggtgatgacacagaagactttgttgctggcgtgcccaaggggaac
ctcacctatggctatgtcaccgtccttaatggctcagacatccactccctctacaacgtc
tcaggagaacagatggcctcctacttcggctatgctgtggctgccactgataccaatgga
gatgggctagatgacctactggtaggggcacccctgctcatggagcggacagctgatggg
agacctcaggaggtgggcagggtctacatctatctgcagcgcccagcgggcatagatccc
acacccaccctcaccctcactgggcaagatgagttcagccgattcggcagctccttgaca
cccttgggggacctggaccaagacggctacaatgatgtcgccattggggctccatttggt
ggggaggcccagcagggagtcgtatttatattcccgggaggcccaggaggactgagcact
aaaccttcccaggttttgcagcctctttgggcagctggccgtaccccagacttctttggc
tctgcccttcgaggaggacgagatctggatggcaatggataccctgatctaatcgttgga
tcctttggtgtggacaaggctctggtgtacagagggcggcccatcatatctgccagcgca
tctctcaccatcttcccctccatgttcaacccagaggagcgcagttgcagcctggaaggg
aaccctgtgtcctgcatcaaccttagcttctgcctcaatgcctctggaaaacatgtcccc
aactctataggcttcgaggtggaactccaactggactggcagaagcaaaagggaggggtc
cggcgggcactgttcctgacttccaagcaggccacccttacccagaccctgcttatccag
aatggggctcgggaggactgcagggagatgaagatctacctcaggaatgaatcagaattc
agagacaaactctccccaattcacattgccctcaacttctccttggaccccaaagctccc
atggacagccatggcctccggccagttctacactaccaaagcaaaagcaggatagaggac
aaggcccagatcttgctggactgtggtgaagacaatatctgtgtgcctgacctgcagctg
gatgtgtatggggagaagaaacatgtgtacctgggtgacaagaacgcactgaacctgaca
ttccatgcccaaaatctgggtgagggcggtgcctatgaagccgagcttcgggtcacagcc
cctctagaggccgagtactcaggacttgtcagacacccagggaacttctccagcctgagc
tgtgactactttgctgtgaaccagagccgccagctggtgtgtgacctgggcaaccccatg
aaggcaggcaccagtctctggggtggccttcggttcactgttcctcatcttcaagacaca
aagaaaaccatccagtttgactttcagatcctcagcaagaacctgaacaactcacaaagc
aacgtggtctccttcccactctcggtggaggctcaagcccaggtctcccttaatggtgtc
tccaagcctgaagctgtgattttcccagtcagcgactggaatcctcaagaccagcctcag
aaggaggaagacttgggcccagctgtccaccatgtctacgagctcatcaaccaggggccc
agctccatcagccagggtgtgctggagctcagctgtccacaggctctggaaggccaacag
ctcctctatgtgaccaaggtgacaggactcagcaactgcacctccaactacacccccaac
tcacagggcctggagttggatccagagacctctccacaccacctgcagaaacgagaggct
ccagggaggagttctactgcctcaggaacacaagttctgaaatgccctgaagccaagtgt
ttcaggctgcgctgtgagtttgggccactgcaccgccaagagagccgtagtctgcagctg
catttccgagtctgggccaagaccttcttgcagcgggaataccagccatttagccttcag
tgtgaggctgtatatgaagctctgaagatgccctaccagatcctgcctcggcagcttccc
caaaagaaacttcaggtggccacagccgtgcagtggaccaaggcagaaggcagcaatggt
gtcccgttgtggatcatcatcctagccattctttttggcctcctgctcctaggtctgctc
atctacgtcctctacaagctcggcttcttcaaacgttccctcccctacggcacagccatg
gaaaaagctcagctcaagcctccagccacctcagatgcctga

KEGG   Mus musculus (mouse): 16403Help
Entry
16403             CDS       T01002                                 

Gene name
Itga6, 5033401O05Rik, AI115430, Cd49f, VLA-6
Definition
(RefSeq) integrin alpha 6
  KO
K06485  integrin alpha 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05145  Toxoplasmosis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16403 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16403 (Itga6)
   04514 Cell adhesion molecules (CAMs)
    16403 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16403 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16403 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16403 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16403 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16403 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16403 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16403 (Itga6)
   05414 Dilated cardiomyopathy (DCM)
    16403 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16403 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16403 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16403 (Itga6)
   04515 Cell adhesion molecules [BR:mmu04515]
    16403 (Itga6)
   04090 CD molecules [BR:mmu04090]
    16403 (Itga6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16403 (Itga6)
  Exosomal proteins of breast milk
   16403 (Itga6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16403 (Itga6)
CD molecules [BR:mmu04090]
 Proteins
  16403 (Itga6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 16403
NCBI-ProteinID: NP_001264899
MGI: 96605
Ensembl: ENSMUSG00000027111
Vega: OTTMUSG00000013266
UniProt: Q61739 Q6PEE8
LinkDB All DBs
Position
2 C2-C3; 2 42.79 cM
AA seq 1091 aa AA seqDB search
MAVAGQLCLLYLSAGLLARLGTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPMSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGK
WSNVKPIRLNGTKDSMFGISVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSPTGIITK
PTQVLEGTSPYFGYSIAGNMDLDRNSYPDLAVGSLSDSVTIFRSRPVINILKTITVTPNR
IDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHNEINYLKLKESHNSRK
KRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNST
FLEEYSKLNYLDILLRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYSGVAWWIILL
AVLAGILMLALLVFLLWKCGFFKRSRYDDSIPRYHAVRIRKEEREIKDEKHMDNLEKKQW
ITKWNENESYS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcgggccagttgtgcctgctctacctgtccgcggggcttctagcccggctg
ggtacagccttcaacctggacacccgcgaggacaacgtgatccggaaatcgggggatccc
gggagcctcttcggcttctcgctcgccatgcactggcagttgcagccggaggacaagcgg
ctgttgcttgtgggggcacctcgggcagaagcactcccgctgcagagggcgaacagaaca
gggggcctgtacagctgtgacatcacctcccggggaccttgtacacggattgaatttgat
aatgacgctgatcctatgtcagaaagcaaggaagaccagtggatgggagtcactgttcag
agccaaggtccagggggcaaagtggtgacgtgtgcacatcgatatgagaaacggcagcac
gtcaacacgaagcaggagtcgcgggatatctttggaagatgttatgtcctaagtcagaat
ctcagaattgaagatgatatggacggaggagactggagtttctgcgatggccggttgaga
ggccatgaaaagtttggctcctgtcagcaaggagtagcggctactttcactaaggacttt
cattacattgtttttggagccccagggacttacaactggaaagggatcgtccgtgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccctatgaagttggt
ggagagactgatcatgatgaaagtctcgtgcccgttcctgctaacagttacctaggcttt
tcactggactcagggaagggtattgtttctaaagatgacatcacttttgtgtctggtgct
ccaagagccaatcacagtggggctgtagttttgctaaaaagagacatgaagtccgcgcat
ctgctccctgagtatatatttgacggagaaggcctggcttcctcgtttggctatgatgtg
gcagtggtggacctcaatgcagatgggtggcaagacattgttatcggagctccacagtat
tttgatagggatggtgaagtcgggggtgcagtttacgtctacattaaccagcaaggcaaa
tggagtaatgtgaagccgattcgtctaaatgggaccaaagactcgatgtttggaatctct
gtgaaaaatataggtgatattaaccaagatggctatccagatattgctgttggagctccc
tatgatgatctggggaaggtttttatctatcatggatccccgactggcataattaccaag
ccaacacaggttctcgaggggacatcgccttacttcggctattcaatcgctgggaatatg
gacctggatcggaattcctaccccgaccttgctgtgggctccctctcagactcggtcact
attttcagatcccggccagtgattaacattctaaaaaccatcacagtgactcctaacaga
attgacctccgccagaagtccatgtgtggctcacctagcgggatatgcctcaaggttaaa
gcctgttttgaatatactgcgaaaccttccggttataaccctccaatatcaattttgggt
attctcgaagctgaaaaagaaagaagaaagtcagggttgtcatcgagagttcagtttcga
aaccaaggttccgagccaaagtatactcaggagctgaccctgaatcggcagaagcagcgg
gcgtgcatggaggagaccctctggctgcaggagaacatcagagacaagctgcgtcccatc
cccatcacggcttctgtggagatccaggagcccagctctcgccggcgggtgaactcactc
cccgaagttcttcccatcctgaattcaaatgaagccaaaacggtccagacagatgtccac
ttcttaaaggaaggatgtggagacgacaatgtctgtaacagcaaccttaagctagagtat
aaatttggtacccgagaaggaaatcaagacaaattctcttaccttccaattcaaaaaggc
atcccagaattagtcctaaaagatcagaaagatatagctctggaaataacggtgaccaac
agcccttcggatccaaggaatccccggaaagatggcgacgatgcccatgaagccaaactc
atcgccacgtttccagacactctgacatattccgcttacagagaactgagggctttccct
gagaagcagctgagctgtgtggccaaccagaatggctcccaagccgactgtgagctcgga
aatcctttcaagagaaattccagtgttactttctatctgattttaagtacaaccgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggctccaattacagcgaaggcaaaagtggttattgaattgcttttatcggtctcc
ggagtcgctaagccttcgcaggtgtattttggaggtacagttgttggtgagcaagctatg
aaatctgaagatgaagtaggaagtttaatagagtatgaatttagggtgattaacttaggc
aagcctcttaaaaacctcggcacagcaaccttgaatatacagtggcccaaggagattagc
aatggcaaatggttgctttatttgatgaaagttgaatccaaaggtttggagcagattgtt
tgtgagccacacaatgaaataaactacctgaagctgaaggagtctcacaactcaagaaag
aaacgggaacttcctgaaaaacagatagatgacagcaggaaattttctttatttcctgaa
agaaaataccagactctcaactgcagcgtcaacgtgaggtgtgtgaacatcaggtgccca
ctgcgagggctggacagcaaggcctctctcgttcttcgttccaggttgtggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcctgagggcttccatagat
gtcaccgctgctgctcagaatatcaagctccctcacgcgggcactcaggttcgagtgacg
gtgtttccctcaaagactgtagctcagtattcaggagtagcttggtggatcatcctcctg
gctgttcttgccgggattctgatgctggctctattagtgtttttactgtggaagtgtgga
ttctttaagcgctctaggtacgatgacagcattccccgataccatgcggtgcggatccgg
aaagaagagcgagagatcaaagatgagaaacacatggataacctcgaaaaaaaacagtgg
atcaccaagtggaatgaaaacgaaagttactcatag

KEGG   Mus musculus (mouse): 16404Help
Entry
16404             CDS       T01002                                 

Gene name
Itga7, [a]7, alpha7
Definition
(RefSeq) integrin alpha 7
  KO
K06583  integrin alpha 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16404 (Itga7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16404 (Itga7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16404 (Itga7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16404 (Itga7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16404 (Itga7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16404 (Itga7)
   05414 Dilated cardiomyopathy (DCM)
    16404 (Itga7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16404 (Itga7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16404 (Itga7)
   04515 Cell adhesion molecules [BR:mmu04515]
    16404 (Itga7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16404 (Itga7)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16404 (Itga7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF3328 LYRIC
Motif
Other DBs
NCBI-GeneID: 16404
NCBI-ProteinID: NP_001317089
MGI: 102700
Ensembl: ENSMUSG00000025348
UniProt: Q3TZS3
LinkDB All DBs
Position
10 D3; 10 77.2 cM
AA seq 1140 aa AA seqDB search
MARIPRCDFLRPPGIYYLITSLLAGLFLPPAIAFNLDVMGAIRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYESRQRVDQALETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAATFSPDSHYLVFGAPGTYNWKGTARVELCAQGSPDLAH
LDDGPYEAGGEKEQDPRLIPVPANSYLGFSIDSGKGLMRSEELSFVAGAPRANHKGAVVI
LRKDSASRLIPEVVLSGERLTSGFGYSLAVTDLNNDGWADLIVGAPYFFERQEELGGAVY
VYMNQGGHWADISPLRICGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARPVLH
VSQEIFIDPRAIDLEQPNCADGRLVCVDIKICFSYVAVPSSYSPSVALDYMLDGDTDRRL
RGQVPRVTFLSRGLDDLRHQSSGTVWLKHQHDRVCGDTVFQLQENVKDKLRAIVVTLSYG
LRTPPLGRQAPGQELPTVAPILNAHQPSTQRTEIHFLKQGCGEDKICQSNLQLERYQFCS
RISDTEFQALPMDLDGRTALFALSGQPFIGLELTVTNLPSDPARPQADGDDAHEAQLLVT
LPASLRYSGVRALDSVEKPLCLSNDSASHVECELGNPMKRGAQVTFYLILSTSGITIETT
ELEVKLLLATISEQELDPVSVRAHVFIELPLSISGVATPQQLFFSGEVKGESAMRSERDV
GSKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGKRGICS
PRPNILQLDVDSRDRRRRELGQPEPQEPPEKVEPSTSWWPVSSAEKRNVTLDCAQGTAKC
VVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYMAVKSLEVIVRANITVKSSIKNLLLRDAS
TVIPVMVYLDPMAVVVEGVPWWVILLAVLAGLLVLALLVLLLWKLGFFKRAKHPEATVPQ
YHAVKIPREDRQQFKEEKTGTIQRSNWGNSQWEGSDAHPILAADWHPELGPDGHPVPATA
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggccaggattccgaggtgcgattttctccggccccccggaatctactatcttattact
tccttgctcgctggactgttcttaccaccggctatcgccttcaatctggatgtgatgggt
gccatacgcaaggagggagaacccggcagcctattcggcttttcggtggccctgcaccga
caattacagccccgaccccagagctggctgctggtgggcgctccccaggccctggctctt
cctggacagcaggcaaaccgcaccggaggcctctttgcttgtcccctgagcctagaggag
acagattgctacagagtggacattgacaggggagctaacgtgcagaaggagagcaaggag
aaccaatggctgggagtcagtgtccggagccaggggccagggggcaagattgttacgtgt
gcacaccgatatgagtctcgacagagagtggaccaggctttggagactcgggatgtgatt
ggccgctgctttgtgctaagccaggacctggccatccgtgatgagctggatggtggggag
tggaagttctgtgaggggcgcccccagggccatgaacagtttgggttctgtcagcagggc
acagctgccaccttctcccctgacagtcactacctcgtctttggggctccaggaacctat
aactggaagggcacggccagggtggagctctgtgcgcagggctcgccggacctggcacac
ctggatgacgggccctacgaggcggggggcgagaaggagcaagacccccgcctcatcccg
gtccctgccaacagctaccttggtttctccatcgattctgggaagggtcttatgcgctca
gaagagctgagttttgtggcaggggccccacgtgccaaccacaaaggggctgtggtcatt
ctgcgcaaggatagcgccagccgcttgatacctgaggttgtgctgtctggggagcgcctg
acctctggctttggctactcactggctgtgactgatctcaacaatgatggctgggcagac
ctgattgtgggtgccccctacttctttgaacgccaagaagagctgggaggtgctgtgtat
gtgtacatgaaccagggtggccattgggcagatatctctcctctccgaatctgtggctcc
cctgattccatgtttgggatcagtttggctgtattgggggacctcaaccaagatggcttc
ccagacattgccgtgggagctccctttgacggagatgggaaggtctttatctaccatggg
agcagccttggggtggttgtcaaaccttcacaggtgctggagggcgaggcggtgggtatc
aagagctttggttactccctgtctggtggcctggatgtggatggaaatcactacccagac
ctgcttgtgggctccctggctgataccgctgctctgttcagggccagacctgttctacat
gtctcccaagagatcttcattgaccccagagccatcgatctggaacaacccaactgtgcc
gatggacgcttggtctgtgtggacataaagatctgtttcagctatgtcgctgtgcccagc
agctacagccctagtgtggccttagattatatgttagatggggacacagaccggaggctc
cggggccaggttccacgtgtgacgtttctgagccgaggcctggatgacctcaggcatcag
tcctccggcaccgtgtggctgaagcaccaacatgaccgagtctgtggagatactgtgttc
cagctgcaggaaaacgtcaaagacaagctacgggccattgtggtgaccctgtcatatggt
ctccgaacccctccattagggaggcaagcacctggccaggagctccccactgtggctccc
atcctcaatgctcaccagcccagcacccagaggactgagatccactttctgaagcaaggc
tgcggtgaagataagatctgtcagagcaacctccagctcgagcggtaccagttctgttcc
aggatcagcgacacagagttccaggctctgcccatggatctggatggaaggaccgccctg
ttcgcattgagtgggcagccgttcataggcctggaactgacagtcaccaacctgccctct
gaccctgcccggcctcaggcagatggggatgatgctcatgaagcacagctcttggtcact
ctcccagcctctctacggtactcaggagtccgtgctctggactctgtggagaagccgctc
tgcctgtccaatgacagcgcctctcatgtcgagtgtgagctggggaaccctatgaagaga
ggcgctcaggtcactttttacctcatcctcagcacctctgggatcactattgagaccaca
gagctggaggtgaaattgctgttagccacgatcagtgagcaggagctggatccggtctcc
gttcgggctcatgtcttcattgaattgccactgtccatttcaggggtggccactccccag
caactcttcttctctggcgaggtgaagggcgaaagtgccatgcgatctgagagggacgtg
ggcagcaaagtcaagtatgaggtcacggtctccaatcaaggccagtctctcaatactctg
ggctctgcgttcctcaacatcatgtggccccacgagatcgccaatggaaagtggctgctg
taccccatgcgggtagagctggagggcggacaggggcctggcaagagagggatctgttcc
ccaagacccaacatcctccagctggatgtggacagcagggataggaggcggcgagagctg
gggcagccggagccgcaggagcctccagagaaggtggagcctagcacatcctggtggcca
gtgtcctctgctgagaagagaaacgtgactctggactgcgcccagggcacggccaagtgt
gtggtgttcagctgcccactctacagctttgatcgtgcagccgtgcttcacgtctggggc
cgcctctggaacagcacctttctggaggagtacatggccgtgaaatccctggaagtgatc
gtccgagccaacatcacagtgaaatcctccattaagaacttgttgctcagagatgcatcc
acagtgattccagtgatggtgtacttggaccccatggccgtggttgtggaaggagtcccc
tggtgggtcatcctcctggcagtgctggctgggctgttagtcctggccttgctggtactg
ctgctgtggaagctgggattcttcaagcgggcgaagcaccccgaggccaccgtgccccag
taccacgcagtgaagatccctcgggaagaccgacagcagttcaaggaggagaagacaggc
accatccagaggagtaactggggcaactcccagtgggagggctccgacgcacaccccatc
ttggctgccgactggcatcctgagctgggtcctgatggacatccggtgccagccactgcc
taa

KEGG   Mus musculus (mouse): 16410Help
Entry
16410             CDS       T01002                                 

Gene name
Itgav, 1110004F14Rik, 2610028E01Rik, CD51, D430040G12Rik
Definition
(RefSeq) integrin alpha V
  KO
K06487  integrin alpha V
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16410 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16410 (Itgav)
   04514 Cell adhesion molecules (CAMs)
    16410 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16410 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16410 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16410 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    16410 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16410 (Itgav)
   05205 Proteoglycans in cancer
    16410 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16410 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16410 (Itgav)
   05410 Hypertrophic cardiomyopathy (HCM)
    16410 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16410 (Itgav)
   05414 Dilated cardiomyopathy (DCM)
    16410 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16410 (Itgav)
   05165 Human papillomavirus infection
    16410 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16410 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16410 (Itgav)
   04515 Cell adhesion molecules [BR:mmu04515]
    16410 (Itgav)
   04090 CD molecules [BR:mmu04090]
    16410 (Itgav)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16410 (Itgav)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16410 (Itgav)
  Exosomal proteins of epithelial cells
   16410 (Itgav)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16410 (Itgav)
CD molecules [BR:mmu04090]
 Proteins
  16410 (Itgav)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 16410
NCBI-ProteinID: NP_032428
MGI: 96608
Ensembl: ENSMUSG00000027087
Vega: OTTMUSG00000013360
UniProt: P43406
LinkDB All DBs
Position
2 D; 2 49.33 cM
AA seq 1044 aa AA seqDB search
MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPST
SSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLHFQVELLLDKLKQKGAIRR
ALFLHNRSPVHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVNSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAAGQGERNHLITKRDLTLREGDVHTLGC
GIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYK
NLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRV
RPPQEEQEREQLQPHENGEGNSET
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccgggcgcctgctgctacgccctcgccccggcggcctcctgctgctgctg
ccgggtctcctgctgcccctcgccgacgccttcaacctggacgtcgaaagtcccgccgag
tatgcgggtcccgagggaagttacttcggattcgccgtggacttcttcgagcccagcacg
tcctccaggatgtttctcctggtgggagcccccaaagcgaacacgacccagcctgggatt
gtagaaggagggcaagttctcaaatgtgaatgctcatccagccgccggtgccagcccatt
gagtttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaagtcc
caccagtggtttggagcctctgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggacggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggccagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
ctcggtggtcctggtagcttttattggcaaggtcagctcatttcggaccaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaattagcaaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtctcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctctttacacaattttactggtgaa
cagatggctgcgtattttggattttctgtagctgctactgacattaatggggatgattac
gcagatgtgtttattggagcccccctgttcatggaccgaggttccgatgggaaactccag
gaggttggccaggtctcagtgtctctgcagagagcagtgggagacttccagactacaaag
ctgaacggctttgaggtttttgccaggtttggaagtgccatagctccattgggagacctg
gaccaggatggcttcaatgatattgcaattgctgctccctatggtggtgaagataagaag
ggacttgtttatatcttcaatggaaggtccacaggcttgaattcggtgccatctcaaatc
ctcgaggggcagtgggctgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagacaggaatggatatccagacttagttgtaggagcttttggtgtggat
cgagctgtcttatacagagccagacccgttgtcactgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataagatctgcccgttgcctgggacagctctcaaggtt
tcctgttttaatgtcagattctgcttaaaggcagatggcaagggaacccttcctcggaag
ctccacttccaggtggagcttctactggataaactcaagcagaagggagccatccgacga
gcactgtttctccataacaggtccccggtccactccaagaccatgactgttttcaggggg
ggacagatgcagtgtgaggaactggtcgcctatcttcgggatgaatctgaatttagagac
aagctcactcccatcaccattttcatggagtatcggttggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
catattctacttgactgtggtgaagacaatgtctgtaaacctaaattggaagtttctgta
aatagtgatcaaaagaagatctatattggggacgacaaccctctgacactgactgtgaag
gcgcagaatcaaggggaaggcgcctatgaagctgagctcatcgtttctatcccaccgcag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaactcggcaggtggtgtgcgaccttggaaacccgatgaaggctgga
actcaactgctcgctggtcttcgtttcagcgtgcaccagcagtcagagatggatacttct
gtgaagtttgacttgaaaatccagagctctaattcttttgacaatgtaagtccagttgtg
tcttacaaggttgacctcgccgttttggctgctgtggagataagaggagtttcaagtcca
gatcatatctttcttccaattccaaattgggagtacaaggaaaaccctgagactgaagaa
gacgttgggcctattgttcagcacatatatgagctgagaaacaatggtccaagttcattc
agcaaggcaattctaaatctccagtggccttacaaatacaacaacaacactctgttgtac
attcttcattacgacattgacgggccaatgaactgcacggcagatacagagatcaaccct
ttgagaatcaagacacccgaaaagaatgacacagcggcggcgggacagggagaaaggaat
catctcatcaccaagcgggatctcaccctcagagagggagatgttcacactttgggctgt
ggaatcgccaagtgcttgcagatcacctgccaggttggtcgactggatagaggcaagagc
gcaatcctgtacgtgaaatccctgctgtggaccgagacgttcatgaacaaggagaaccag
aaccattcctattcgctgaagtcatctgcttcctttaatatcatagaattcccttacaag
aacctgccgatcgaggatctcttcaactctacactagtcaccactaacatcacctggggc
attcagccggcgcccatgcctgtgcctgtgtgggtgatcatcttggcagttctcgcaggg
ctgctgctactggctgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtc
cgaccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaatggcgaagga
aactctgaaacctaa

KEGG   Mus musculus (mouse): 213119Help
Entry
213119            CDS       T01002                                 

Gene name
Itga10, A630048L14
Definition
(RefSeq) integrin, alpha 10
  KO
K06586  integrin alpha 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    213119 (Itga10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    213119 (Itga10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    213119 (Itga10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    213119 (Itga10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    213119 (Itga10)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    213119 (Itga10)
   05414 Dilated cardiomyopathy (DCM)
    213119 (Itga10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    213119 (Itga10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    213119 (Itga10)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   213119 (Itga10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_2 VCBS
Motif
Other DBs
NCBI-GeneID: 213119
NCBI-ProteinID: NP_001289400
MGI: 2153482
Ensembl: ENSMUSG00000090210
Vega: OTTMUSG00000029578
UniProt: E9PXZ3
LinkDB All DBs
Position
3; 3 F2.1
AA seq 1166 aa AA seqDB search
MESLSIPHLLLPLALLTGLCSSFNLDEHHPRLFTGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCSIGGFHSAPCTKGHLGDYQLGNSSQPAVNMHLGMSLLETDADGG
FMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGENPVHEWSLGDFRTKEEVVRAARNLSRREG
RETRTAQAIMVACTEGFSQSRGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
RGENESSFGLEMSEIGFSIHRLQDGILFGMVGAYDWGGSVLWLEEGRRLFPPQAALEDEF
PPALQNHAAYLGYSVSSMLLPGGRRLFLSGAPRFRHRGKVIAFQLKKDGVVRVAQSLQGD
QIGSYFGSELCPLDTDKDGITNILLVAAPMFLGPQNKETGRVYVYMVGQQNLLMLQGTLQ
PDRSQDSRFGFAMAALPDLNHDGFTDVAVGAPLEDGHRGALYLYHGTQTGIRPHPTQRIA
AVSMPQALRYFGRSVDGRLDLDGDDLVDVAVGAHGAAVLFSSQPIIHLIPTLDVMPPHIS
VVQKDCKRRGQEAACLTAALCFQVVSQTPGRWDRRFYIRFSASLDEWTAGARAVFDGSGQ
RLSPRQLQLSVGNVTCEQLHFHALDTSDYLRPVALTVTFALDNTTKPGPVLAEGSSTTIR
KLIPFSKDCGPDNECVTDLVLQADMDIRGSRKSPFVVQGGRQKVLVSATLENKKENAYNT
SLSLSFSRNLHLASLTPQAKSVKVECAVPSPHTRLCTVGHPVFQTGAKVSFLLEFEFSCT
FLLSQVFVRLTASSSSLEMNETLQDNTAQTSAYIRYEPHLVFSSESTLHRYEVHPYRTLP
MGPGPEFKTTLRVQNLGCHVVSGLVISALLPAVAHGGNYFLSLSQVISGNASCTVQNLTE
PPGFPVHPEELQHASRLNGSNSRCQVVRCHLGLLAKGTEISVRLLRLVHNEFFRRAKFKS
VTVVSTFKLGTEEGSVLLLNEASRSSESHLEVIQTHPTLISLWILVGSVLGGLLLLALLV
FCLWKLGFFTRKKIPKEEESEEKLEQ
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctctccatccctcacctgctcctgcccctggcgttgctgacaggtctctgc
tcctcctttaatctggatgaacaccacccacgactcttcacagggccaccagaggccgaa
tttggatacagtgtcttacagcatgttgggggtggacagcgatggatgctggtgggtgcc
ccctgggatgggccatcaggtgaccggagaggggatgtttatcgttgctctataggggga
ttccacagtgctccatgtaccaaaggccacctgggtgactatcaacttggaaattcctct
cagcctgctgtgaatatgcacctagggatgtctctactagagacagatgctgatggggga
ttcatggcctgtgcccctctttggtctcgtgcctgcggcagctctgtcttcagttctgga
atatgtgcccgtgtggatgcttcattccggccccagggaagcctggcacccaccgcccaa
cgctgtcccacatacatggatgtcgtcattgttttggatggctccaacagtatctatccc
tggtcagaagttcagactttccttcggaggctggtaggaagactgttcatcgatccggag
cagatacaggtaggactggtacagtacggggagaaccctgtgcatgagtggtccctggga
gacttccgaacaaaggaagaagttgtgagagcagcaaggaacctaagtcggagggaaggg
cgagaaacgagaaccgcccaagcgatcatggtggcatgcacagaagggttcagtcagtcc
cgggggggacgaccagaggccgctaggctgctggtagttgtcactgatggagagtcccat
gatggagaggaacttccagcagcgctaaaggcctgtgaggctggcagagtgacacgttat
gggattgcggtccttggtcactatctccggcgacagagagaccccagctcttttcttcgg
gaaatcagagctattgctagtgatccagatgagcgattcttcttcaatgtcaccgatgaa
gctgcgctgacagacattgtggatgcactgggggaccgaatttttggtcttgaagggtcc
cgtggagaaaatgaaagctcctttgggctagaaatgtctgagattggcttctccatccac
cgactacaggatgggattctctttgggatggtgggggcctatgactgggggggctccgtg
ctatggcttgaagaaggtcgccgccttttcccaccacaagctgccctggaagatgagttc
ccccctgcgttgcagaaccatgcggcctacctgggttactctgtttcctccatgcttctt
cccggtggacgccgcctctttctctcaggggcaccgaggtttagacatcgaggaaaagtt
atcgccttccagctaaagaaagatggggttgtgagggtcgcccagagcctccagggggat
cagattggctcatactttggcagcgagctctgcccgttggatacagataaggacggaata
actaatatcttacttgtggcggctcccatgttcctgggtccccagaacaaggagaccgga
cgcgtttatgtgtacatggtgggccagcaaaatttgctaatgctccaaggaacccttcag
ccagaccgttcccaggattctcggtttggctttgccatggctgctcttcctgatctgaac
catgatggtttcactgatgtagcggtgggggcacccctggaggatggacaccggggagcg
ttgtacctgtatcatggaacccagactggaatcaggccgcatcctacccagaggattgct
gctgtctccatgccacaggccctccgatacttcggccgaagtgtggatggccgcttagat
ctggatggagatgatcttgtagatgttgccgtgggtgcccacggggcagccgttctgttc
agctcccagcccatcatccacctgattccaaccctggatgtgatgcctccccacatcagt
gtggttcagaaggactgtaaaagacgaggccaggaagcagcctgtctgaccgcagccctt
tgcttccaagtagtgtctcaaactcctgggcgttgggatagaagattctacataagattc
tcagcatcactggatgagtggaccgctggggcacgtgcagtattcgatggctctggtcag
cgcctgtcccctcggcagctccagcttagtgttggcaatgtcacttgtgaacagctgcac
ttccatgcactggatacatcggattacctccggccagtggccttgactgtgacttttgct
ttggacaacaccacgaagccagggcctgtgctggcggaaggatcctctacgactatacgg
aagctgatccccttctcaaaggactgtggccctgacaatgaatgtgtcacagacctggtg
cttcaagctgacatggacatcagaggctccaggaagtccccatttgtggttcaaggtgga
cgacagaaagtgctggtgtctgcgaccctggagaacaagaaggagaatgcctacaacact
agcctgagtctcagcttttctagaaacctccacctggccagtcttactcctcaggccaaa
tcagtgaaggtggagtgcgcagtcccttccccccatacccggctctgcaccgtggggcat
ccggtcttccagactggggccaaggtgagcttcctgttagagtttgaatttagctgcacc
ttcctcctgagccaggtctttgtgaggctgactgccagtagcagtagcctagagatgaat
gagacccttcaagataacacagctcagacctctgcctacatccggtacgaacctcacctc
gtgttctccagtgagtccactctgcatcggtatgaggttcacccttataggactctccca
atgggtcctggccctgaattcaagaccactcttagggttcagaatcttggttgccatgtg
gtcagtggtctcgtcatctccgccctccttccagctgtagcccatgggggtaactacttc
ctgtcactatctcaagtcatctctggcaatgcaagctgcacggtgcagaacctgactgag
cccccgggcttccctgtgcacccagaggagcttcagcatgcaagcagactgaatgggagt
aacagtcgatgtcaggtggtaaggtgccaccttggactgctggcaaaggggactgagatc
tctgtcaggctgctgaggctggttcacaatgaattctttcggagggccaagttcaagtct
gtgacagtggtcagcaccttcaagttaggaactgaggagggcagtgtcctactactgaat
gaagcctcccgctcgagtgagagtcacttggaggtgattcagacccacccgaccctcatc
tccctgtggatcctcgttggcagtgtcctgggggggctgctcctgcttgctctccttgtc
ttctgcctgtggaagcttggcttctttacccgtaagaaaatccccaaagaagaagaaagt
gaggagaagttggagcagtga

KEGG   Mus musculus (mouse): 241226Help
Entry
241226            CDS       T01002                                 

Gene name
Itga8, AI447669
Definition
(RefSeq) integrin alpha 8
  KO
K06584  integrin alpha 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    241226 (Itga8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    241226 (Itga8)
   04514 Cell adhesion molecules (CAMs)
    241226 (Itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    241226 (Itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    241226 (Itga8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    241226 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    241226 (Itga8)
   05414 Dilated cardiomyopathy (DCM)
    241226 (Itga8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    241226 (Itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    241226 (Itga8)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   241226 (Itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 241226
NCBI-ProteinID: NP_001001309
MGI: 109442
Ensembl: ENSMUSG00000026768
Vega: OTTMUSG00000011364
UniProt: A2ARA8
LinkDB All DBs
Position
2 A1; 2 9.12 cM
AA seq 1062 aa AA seqDB search
MSAGTHCGPPGNRAPPFARLCCVSAALGMLWSPACLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSIADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNPRGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGKGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSVRVCASIAGQSISNTIALLAE
VQLDFLKQKGAIKRTLFLHNHQSHFTFPFVMKQQKSLHCQDFMVYLRDETEFRDKLSPIN
ISLNYSLDDSTFKDSLEVKPILNHYRDNVVTEQAHILVDCGEDNLCVPDLKLSARPDKHQ
IIIGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERNNKGLRPLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFERVQINI
TAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHKEEEVGPLVEHIYELHNIGPSTISDSILD
VGWPFSARDEFLLYIFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQLHRQSPARILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLKR
KNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgggaacccactgtggtcccccggggaaccgggcacctccgttcgcgcgtctc
tgttgcgtctcggccgcgctggggatgctgtggtcccctgcgtgtctggcgttcaacttg
gatgtggacaagctcactgtgtacagtggccccgagggcagctacttcggctactcactg
gacttctacatacctgatgcgcgcacagccagtgtcttagtgggggcacccaaagccaac
actagccagccggatatcgtagaagggggagctgtctactactgtccctggccctcagag
aggtctgcacagtgcaagcagataccgtttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagaacctatagaatttaaatcaaaccagtggtttggagccacagtgaga
gctcacaaaggaaaagttgtggcttgtgcccctttgtatcactggagaactctgaaacct
aatccagcgaaggacccagttggcacatgctatgtagcaattcagaatttcagtgcctat
gctgagcactcaccttgtcgaaacagcaatgctgatcccgaaggccaaggttactgccag
gcagggtttagcctagacttctataagaatggagaccttatagtgggaggacctggaagt
ttttactggcaaggtcaggtgatcactgtcagtatagcagacatcattgcaaattactca
ttcaaggatattctacgaaaattggccgcagaaaagcagacagacgtggctccagcttcc
tatgatgacagctaccttggatattcggtcgctgctggagaattcactggggactctcag
caagaattggtggctgggattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagacatgaccttcattcagaattttactggtgagcagatggcatcttatttc
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggtcggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggacaggtctac
ttgtaccttcaagcaagcgccctcctcttccaagacccacaggtcctcaccggcacggag
acatttgggagatttggtagctctgtggcccacttgggggacctgaaccaagatggatac
aatgacatcgccatcggtgtgccctttgcaggcaaggatcaacgaggtaaagtcctcatt
tacaatggaaacccaagaggtttacacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggatttggcttttctctaagaggagatgcagacatagac
aagaatgattacccagatttgcttgtaggggcatttggaaaagggaaagtagctgtttac
agagcaaggccagttgtaaccgtggatgcccagcttctgctgcacccgatgattatcaac
cttgaaaataaaacttgccagattccagaattccctactcctgtggcctgcttttctgta
agagtctgtgcatctatagcaggccagagcatttcaaatacaatagccctgctggccgag
gtgcagttagatttcctgaagcaaaaaggagccatcaaacggacgctctttctccacaac
caccagtcccatttcaccttcccctttgtgatgaagcagcagaaatccctccactgccag
gattttatggtttaccttcgggatgaaactgaattccgagataaattgtctccaatcaac
atcagcctgaactacagtttggatgattctacctttaaagacagcctggaagtgaagcca
attttgaaccactacagggacaatgtagttactgagcaggctcacatcctggtggactgt
ggagaagacaatctatgcgttcctgacttgaagctgtcagctagaccagataagcatcag
ataattattggcgatgaaaatcacctaatgctcataataaatgcaagaaatgagggagaa
ggggcctacgaagccgaactctttgttatcatccccgaagaagcagattatgttgggatt
gagcgcaacaacaagggactgaggcccctgagttgtgagtacaagatggaaaacgtgacc
aggatggtggtgtgtgaccttgggaacccgatggtgactggaacaaatttttctctgggc
ctccgatttgctgttcctcgccttgagaaaacaaatatgagcattaacttcgatctccaa
atcagaagctccaataaggacaatcctgacagcaacttcgagcgtgtacagatcaacatc
actgccattgctcaggtcgaaatcagaggagtgtcccaccctccgcagattgttctgccc
atccacaactgggaaccagaaaagaagccacacaaagaggaggaagtcggtcctttggtt
gagcatatttatgagctgcacaatattggacccagcaccatcagtgacagcattcttgac
gtgggctggccgttctctgcacgggatgagtttctcctctatatttttcatcttcaaact
ctgggacctctacaatgtcaaacaaatcctgagatcaacccacaggatataaagcctgct
gcctccccagaggatacccctgagctcagtgccttcttaagaaatgctacaattccccat
cttgtcagaaagagggatgtgccagtggtccagctccacagacagagccctgcaagaata
ctgaactgtaccaacattgactgcttgcaaatctcttgtgcagtgggtcgcctgggagga
ggcgaaagtgcagtcctaaaggtcagatcgagattgtgggcccacacgttcctcaagaga
aagaatgatcattatgctcttgcatccctggtgtcctttgaagtcaagaagatgccgtat
aaagaacagccagcaaagctgccagcggggagcacagcggttaagacgtcggttatttgg
gccactccgaatgtctccttctcaattccattgtgggtcataatactagcgatccttctt
ggtttgctggttctggctatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggatgaaatgacagacagggaacaactgaccagtgacaagacccca
gaggcgtga

KEGG   Mus musculus (mouse): 319480Help
Entry
319480            CDS       T01002                                 

Gene name
Itga11, 4732459H24Rik
Definition
(RefSeq) integrin alpha 11
  KO
K06587  integrin alpha 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    319480 (Itga11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    319480 (Itga11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    319480 (Itga11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    319480 (Itga11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    319480 (Itga11)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    319480 (Itga11)
   05414 Dilated cardiomyopathy (DCM)
    319480 (Itga11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    319480 (Itga11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    319480 (Itga11)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   319480 (Itga11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA VWA_2 FG-GAP FG-GAP_2 VCBS Ku_N
Motif
Other DBs
NCBI-GeneID: 319480
NCBI-ProteinID: NP_795896
MGI: 2442114
Ensembl: ENSMUSG00000032243
Vega: OTTMUSG00000026249
UniProt: Q8CE84 Q7TQC3 A0A0B4J1F0
LinkDB All DBs
Position
9; 9 B
AA seq 1188 aa AA seqDB search
MDFPRGLLVAWTLSLWPGFTDTFNMDTRNPRVIAGPSAAFFGYTVQQHDISGKKWLVVGA
PMETNGHQKTGDVYKCPVTQGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGIVQYGEDAVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIRQSEKDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGILLGAVGAYDWNGAVLKETSAGKVIPHRESYLKEFPEELKN
HAAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFSMHNNRSLTIHQALRGEQIGSYF
GSEITSVDVNDDRVTDVLLVGAPMYFSEGRERGKVYVYNLRQNRFVYNGTLKDSHSYQNA
RFGSCIASVQDLNQDSYNDVVVGAPLEDSHRGAIYIFHGFQTNILKKPMQRITASELAPG
LQHFGCSIHGQLDLNEDGLVDLAVGALGNAVVLWARPVVQINASLHFEPSKINIFHKDCK
RNGRDATCLAAFLCFIPIFLAPHFQTATVGIRYNATMDERRYMPRAHLDEGGDQFTNRAV
LLSSGQEHCQRINFHVLDTADYVKPVAFSVEYSLEDPDNGPMLDNGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLGRPAQDCSSYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSAVLNISQSENLQFASLIQKDDSDNSIECVNEERRLHKKVCNVSYPFF
RAKAKVAFRLDFEFSKSVFLHHLQIHLGAGSDSHEQDSTADDNTALLRFHLKYEADVLFT
RSSSLSHFEVKANSSLESYDGIGPPFNCVFKVQNLGFFPIHGVMMKITVPIATRGGNRLL
MLRDFFTDQGNTSCNIWGNSTEYRSTPTEEDLSHAPQRNHSNSDVVSIICNLRLAPSQET
SFYLVGNLWLTSLKALKYRSLKITVNAALQRQFHSPFIFREEDPSRQVTFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSAKRKREPGLGPIPKELK
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggactttcccaggggcctcctggtggcctggaccctcagcctttggccaggattcacg
gacaccttcaatatggataccagaaatccccgggtcattgctggtcccagtgctgccttc
tttggctacacagtacagcagcatgatatcagtggcaagaagtggttggttgtgggtgcc
ccaatggaaaccaatggccatcagaagacaggagacgtatacaaatgtccggtaacccag
ggcaactgcaccaagctcaacctgggcagggtcactctgtccaatgtgtctgagaggaag
gacaacatgcgcctcggcctgagccttgccaccaaccccaaggacaacagcttcctggcc
tgcagccctctctggtcgcacgagtgtggaagctcctactacaccactggcatgtgctca
cgggtcaactccaacttcagattctctaagacggtagctccggcacttcagaggtgccag
acttacatggacatcgtcattgtcttagatggctccaacagcatctacccctgggtggag
gtccaacacttcctcatcaatatcctcaaaaagttctacattggccccggccagatccag
gtcggaatagtccagtatggagaagatgccgtccatgagttccaccttaatgactacagg
tctgtaaaagatgtggtggaagccgccagccacattgagcagagaggagggacagagacc
cgcacggcatttggcattgaatttgcacgctcggaggctttccagaagggtggaagaaaa
ggggccaagaaagtgatgattgtcatcacggacggggaatcccacgacagcccagacctg
gagaaggtgatccggcagagcgagaaggacaacgtgaccagatacgctgtggccgttttg
ggctactacaaccgcagggggatcaatccagagacttttctaaatgaaatcaaatacatc
gccagcgaccctgacgacaagcacttcttcaacgtcacagatgaggcggccctgaaggac
attgttgatgcccttggggacaggatcttcagcttggaaggcaccaacaagaatgagacc
tcttttgggctggagatgtcgcagactggcttttcttcacatgtggtagaggatgggatc
ctgctgggagctgtgggagcctatgactggaacggggcggtgctgaaggagacaagtgct
ggcaaggtgattcctcaccgagagtcctaccttaaggagtttccagaggagctgaagaac
catgcagcatacctagggtacacggtgacgtcggttgtgtcctccaggcaggggcgggtg
tatgtggctggagcccccagattcaaccatactggcaaggtcattctattcagcatgcac
aacaaccggagcctcaccatccaccaggctcttcggggcgagcagataggctcctacttt
gggagtgagattacctcagtggacgtcaatgatgacagagtgacagatgtgctgctggtg
ggtgcacccatgtacttcagcgagggccgagagcgaggcaaggtgtatgtctacaacctg
agacagaaccggtttgtttataatggcactctgaaggattcccacagctaccagaacgcc
cggttcgggtcctgcatcgcctctgttcaagacctcaaccaagattcctacaatgatgtg
gtggtgggggcccctctggaggacagccacagaggggccatctacatcttccatggcttc
caaaccaatatcctgaagaagcccatgcagagaataacagcctcggagctggctcctggc
ctgcagcattttggctgcagcatccacggacaactggacctcaatgaggatgggcttgtg
gacctagcagtgggcgccctgggcaacgctgtggttttgtgggcccgccctgtagttcaa
atcaacgccagcctccactttgagccttccaagatcaacatcttccacaaggactgcaag
cgcaatggcagggatgccacctgcctggccgccttcctctgcttcatacccatcttcctg
gcaccccacttccaaacagcaaccgtcggcatcaggtacaatgcaaccatggatgagagg
cggtatatgccgcgggcacatctggacgagggcggagaccagttcaccaacagagccgtc
ctgctctcctctggccaggaacactgtcaaaggatcaacttccatgtcctggacactgca
gactacgtgaagccagtggccttctccgtggagtactccctagaggaccctgacaacggc
cccatgctggacaacggctggcccactacgctcagagtgtcggtgcccttctggaatggc
tgtaatgaggatgaacactgtgtccctgaccttgtactggatgctcggagtgacctgccc
actgccatggagtactgccagcgggtgctggggaggccggcgcaggactgctccagctac
accctgtccttcgacaccactgtcttcatcatagagagcacgcgccgccgggtggcagtg
gaggccacgctggagaacagaggagagaatgcttacagcgccgtcctcaacatctcccag
tcagagaaccttcagtttgccagcctgatccagaaggatgactcagacaacagcatcgag
tgtgtgaacgaggagaggcggcttcacaagaaagtctgcaacgtcagctaccccttcttc
agagccaaggccaaggtggctttccgtctggatttcgagttcagcaagtctgtgtttctg
caccatcttcagatccatctgggtgccggcagtgacagtcacgagcaagacagcaccgca
gacgataacacggccctcctgcgcttccacctcaaatatgaagcagacgtcctctttacc
agaagcagcagcctgagccacttcgaggtcaaggcaaacagctcacttgagagctatgat
ggcatcggacctccgttcaactgtgttttcaaggtgcagaacctgggctttttccccatc
cacggggtgatgatgaagatcactgtgcccatcgccaccaggggtggcaaccgcctgctg
atgttgagggacttcttcaccgaccagggcaacacatcctgtaacatctgggggaacagc
acagagtacaggagtaccccaactgaggaagatctgagccatgccccacagaggaatcac
agcaactccgacgtggtctccatcatctgcaacctgaggctggcccccagccaggagacc
agcttctacctggtgggaaacctgtggctgacatctctgaaagcactcaagtacaggtct
ctgaagatcacagtcaacgccgccttgcagaggcagttccacagccccttcatcttccga
gaggaagaccctagccgccaggtcacatttgagatctccaagcaagaagactggcaggtc
cccatctggatcatcgtgggcagcactctggggggcctcttgctgctggccctgctggtc
ctggcactgtggaagctcggtttttttaaaagtgccaagcgcaagagggaacctggccta
ggccccatccccaaagagctcaagtga

DBGET integrated database retrieval system