KEGG   Mus musculus (mouse): 104110Help
Entry
104110            CDS       T01002                                 

Gene name
Adcy4, mKIAA4004
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104110 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104110 (Adcy4)
   04371 Apelin signaling pathway
    104110 (Adcy4)
   04020 Calcium signaling pathway
    104110 (Adcy4)
   04072 Phospholipase D signaling pathway
    104110 (Adcy4)
   04024 cAMP signaling pathway
    104110 (Adcy4)
   04022 cGMP-PKG signaling pathway
    104110 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104110 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104110 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104110 (Adcy4)
   04062 Chemokine signaling pathway
    104110 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    104110 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    104110 (Adcy4)
   04912 GnRH signaling pathway
    104110 (Adcy4)
   04913 Ovarian steroidogenesis
    104110 (Adcy4)
   04915 Estrogen signaling pathway
    104110 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    104110 (Adcy4)
   04921 Oxytocin signaling pathway
    104110 (Adcy4)
   04926 Relaxin signaling pathway
    104110 (Adcy4)
   04918 Thyroid hormone synthesis
    104110 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    104110 (Adcy4)
   04916 Melanogenesis
    104110 (Adcy4)
   04925 Aldosterone synthesis and secretion
    104110 (Adcy4)
   04927 Cortisol synthesis and secretion
    104110 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104110 (Adcy4)
   04270 Vascular smooth muscle contraction
    104110 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    104110 (Adcy4)
   04971 Gastric acid secretion
    104110 (Adcy4)
   04972 Pancreatic secretion
    104110 (Adcy4)
   04976 Bile secretion
    104110 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    104110 (Adcy4)
   04727 GABAergic synapse
    104110 (Adcy4)
   04725 Cholinergic synapse
    104110 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    104110 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    104110 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    104110 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    104110 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    104110 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104110 (Adcy4)
   04714 Thermogenesis
    104110 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104110 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    104110 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    104110 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104110 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104110 (Adcy4)
   05163 Human cytomegalovirus infection
    104110 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104110 (Adcy4)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104110 (Adcy4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Motif
Other DBs
NCBI-GeneID: 104110
NCBI-ProteinID: NP_536683
MGI: 99674
Ensembl: ENSMUSG00000022220
UniProt: Q91WF3
LinkDB All DBs
Position
14; 14 C3
AA seq 1077 aa AA seqDB search
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCALVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWVALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWQPESQRALLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQRSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVERADTEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHTMRPSLLMTR
YLESWGAAKPFAHLSHLDSPVSTSTPLPEKAFSPQWSLDRSRTPRGLDDELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQM
LVTTRPPALIITYSITFLLFFLLLFVCFSEHLTKCVQKGPKMLHWLPALSVLVATRPGFR
VALGTATILLVFTMAIASLLFLPVSSDCLFLASNVSSVTFNASWEMPGSLPLISIPLISI
PYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYQSPS
DSRPGVLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLT
RLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLEC
LRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSERSCSHLGT
MVEFAVALGSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRME
STGVLGKIQVTEETARALQSLGYTCYSRGSIKVKGKGELCTYFLNTDLTRTGSPSAS
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcctcctcccagcgaagatctcttctacgaaacttac
tacagcctgagccaacagtacccactgctgatactgcttttggtcattgtgctctgcgcg
ctggtggcactgcccgccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaactgtgctgtgtgctttgggtggcttctctctgctattggggcttgcttcc
cgggagcagcaactgcagcgatggacacgacctctttctggtctcatatgggttgcatta
ctggctctgggctatggatttctgttcactgggggtgtggtgagcgcctgggaccaggtg
tcttttttcctcttcatcatcttcaccgtgtacgccatgctgcccttgggcatgcgggat
gctgctgctgcgggagtcatctcatccctctcgcacctgctggtccttggactgtatctt
gggtggcagcctgagtcacagagagctctgctaccacagttggcagcaaacgcggtattg
ttcctgtgtgggaacgtggtgggagcgtaccacaaggccctgatggagcgagcattgcgg
gccacgttccgggaggctcttagctctctgcactcacgccggaggctggacactgagaaa
aagcaccaggagcacctcctcttgtctatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcccggctgcaggctggacagcgctcacggccagagaacacaaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtgagtgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttccccgaaggagctggtgctcatgctgaatgag
ctctttggcaagttcgaccaaattgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgcccctctcgctgcctgaccacgctatcaat
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggtagccaccggt
gtggatatcaacatgcgtgtgggcgtgcactcgggcagcgttctctgtggagtcattggg
ctacagaagtggcagtatgatgtctggtcccatgatgtcacattggccaaccatatggaa
gcaggcggtgtaccaggacgagtgcacatcacaggggccacgctggccctgctagcagga
gcttatgctgtggagagggcagacacggaacaccgagacccataccttcgggagctagga
gaacctacatacctggtcattgatcctcgggctgaggaggaagacgagaagggcaccgca
aaaggattgctgtcttctctggaggggcacacgatgcgtccgtcactactgatgactcgc
tatctggagtcttggggtgcagccaagcctttcgcccacctaagccaccttgacagtccc
gtgtccacctccactccactcccggagaaagccttcagcccccagtggagcctggaccgg
agtcgcaccccccggggactagatgatgaactggacactggtgatgctaagttcttccag
gtcatcgaacaactcaactctcagaaacagtggaagcagtcgaaggacttcaacctcctg
acgctgtacttcagagagaaggagatggagaaacagtatcggctctctgcactccccgcc
ttcaaatactacgcagcctgcaccttcctggtttttctgtccaacttcactatccaaatg
ctggtgacaaccaggcccccagctctgatcatcacctacagcatcaccttccttctcttc
tttctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtccagaaaggtccc
aagatgttgcactggctgcctgcactgtctgtcctggtggccacacggccaggatttcga
gtagccctgggtacggccaccatcctcctggtattcactatggccatcgccagcctgctc
ttcttaccagtgtcatcagactgccttttcctggcttccaatgtgtcatctgtgactttc
aatgcttcctgggagatgccaggatccctgcccctcatcagcatccccctcatcagcatc
ccatactccatgcattgctgcgtgttgggtttcctctcctgctccctttttctgcacatg
agcttcgaactgaagctgctcctacttctgctgtggctggtggcatcttgttccctattt
ctgcattcccacgcctggctgtctgactgcctcattgcccgcctttatcaaagcccttcg
gactccagaccaggggtactgaaggaacccaagctgatgggagcgatctacttcttcatc
ttcttcttcacactcctggtcctggctcggcagaatgagtattactgccgcctggacttc
ctgtggaaaaagaaactgaggcaggagcgagaggagactgagacaatggagaacctgacc
cggctcctcctggagaatgtactccctgcacacgtggccccccagttcatcggccagaac
cggcgcaatgaggacctctaccaccagtcgtacgaatgcgtttgtgtcctcttcgcgtcg
gtcccagactttaaggaattctactctgaatccaacatcaaccacgaggggctggagtgc
ctgcggctgctcaatgagatcattgctgactttgatgagctgctctccaagccaaagttc
agtggagtagagaagatcaaaactattggcagtacctacatggcggccacaggcttaaat
gccacctctggacaggatactcagcaggattctgagagaagctgcagtcatctgggcacc
atggtggaatttgcagtggccctggggtctaagctgggagtcatcaacaagcactcgttc
aataacttccgcctgcgtgtggggttgaaccacggaccagtagtagcaggggtgattggg
gcgcagaagccacagtacgacatctgggggaacacagtgaatgtggccagccgaatggag
agcacaggcgttctcggcaagatccaagtgactgaggagacagcgcgggccctgcagtcc
ctgggttacacgtgctatagcagaggcagcatcaaggtcaaaggcaaaggggaactctgt
acctacttcctgaacacagacctgacgcggaccggatctccctcagcatcctag

KEGG   Mus musculus (mouse): 104111Help
Entry
104111            CDS       T01002                                 

Gene name
Adcy3, AC3, ACIII, mKIAA0511
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104111 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104111 (Adcy3)
   04371 Apelin signaling pathway
    104111 (Adcy3)
   04020 Calcium signaling pathway
    104111 (Adcy3)
   04072 Phospholipase D signaling pathway
    104111 (Adcy3)
   04024 cAMP signaling pathway
    104111 (Adcy3)
   04022 cGMP-PKG signaling pathway
    104111 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104111 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104111 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104111 (Adcy3)
   04062 Chemokine signaling pathway
    104111 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    104111 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    104111 (Adcy3)
   04912 GnRH signaling pathway
    104111 (Adcy3)
   04913 Ovarian steroidogenesis
    104111 (Adcy3)
   04915 Estrogen signaling pathway
    104111 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    104111 (Adcy3)
   04921 Oxytocin signaling pathway
    104111 (Adcy3)
   04926 Relaxin signaling pathway
    104111 (Adcy3)
   04918 Thyroid hormone synthesis
    104111 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    104111 (Adcy3)
   04916 Melanogenesis
    104111 (Adcy3)
   04925 Aldosterone synthesis and secretion
    104111 (Adcy3)
   04927 Cortisol synthesis and secretion
    104111 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104111 (Adcy3)
   04270 Vascular smooth muscle contraction
    104111 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    104111 (Adcy3)
   04971 Gastric acid secretion
    104111 (Adcy3)
   04972 Pancreatic secretion
    104111 (Adcy3)
   04976 Bile secretion
    104111 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104111 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104111 (Adcy3)
   04727 GABAergic synapse
    104111 (Adcy3)
   04725 Cholinergic synapse
    104111 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    104111 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    104111 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    104111 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    104111 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    104111 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104111 (Adcy3)
   04714 Thermogenesis
    104111 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104111 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    104111 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    104111 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104111 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104111 (Adcy3)
   05163 Human cytomegalovirus infection
    104111 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104111 (Adcy3)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104111 (Adcy3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N fn3_4 NCE101
Motif
Other DBs
NCBI-GeneID: 104111
NCBI-ProteinID: NP_612178
MGI: 99675
Ensembl: ENSMUSG00000020654
Vega: OTTMUSG00000033731
UniProt: Q8VHH7 Q80TY9
LinkDB All DBs
Position
12; 12 A1.1
AA seq 1145 aa AA seqDB search
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGFGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSAVPNGAPASSKPSSPALIETKEPNGSAHAS
GSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANV
VDMLSCLQYYMGPYNMTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTALNLYAWCPVFDEYDHKRFQEKDSPMVALEKMQVLATPGLNGTDSRLPLVPSK
YSMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQ
VVDNP
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagctgaatac
tcggtcagcctgccctctgaccccgaccgcggggtcggccggacccatgaaatttctgtg
cggaactcggggtcctgcctgtgcctgcctcgctttatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctacttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtagtgatgtgcgcggtggtcttc
tccagcgacaagctggcgcccctcatggtggcaggcttcggtctggtgttggacatcatc
cttttcgtgctctgtaaaaaggggctgctcccggaccgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatctcggcccagatcttctcctacctgggcctgaacttttca
cgggcccacgcagccagtgacactgtgggttggcaggctttctttgtcttctccttcttc
ataacgctgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgtgttgtg
cacacgcttgtgttgggggtcactgtggcccagcagcagcaggatgagctggaagggatg
cagctgctgagggagatcctggccaacgtcttcctctacctgtgtgctatcatcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcactggaggtgaagatgaatctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaataccatgtacatgtaccggcacgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagctgtcctctgcttgcagtgcccaggagctc
gtgaagttactcaacgagctcttcgcccgctttgacaagctggcagccaaataccaccag
ctgaggatcaagatcctaggcgactgttactactgcatctgcggcttgcctgactaccgg
gaggaccatgccgtgtgctccatccttatggggcttgccatggtagaggccatctcgtac
gtgcgggagaagaccaagactggagtggacatgcgtgtgggagtgcacacaggcactgtc
ctaggcggtgtcctgggccagaagcgctggcagtatgatgtatggtctactgatgtcacc
gtggcaaacaagatggaggctggtggcatcccagggcgcgtgcacatttcccagagcacc
atggactgcctgaagggggagtttgatgtggagcctggtgatgggggcagtcgctgcgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagcccaaaatggcctcaacggctcggccgtgccaaacggagcgccggcatcctcc
aaacccagctcccctgccctcatcgagaccaaggagcccaatggaagtgcccatgccagc
ggctccacatcagaggaggctgaagaacaggaggcccaggctgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggcggaccgtgtggtggacgcctctgag
gatgagcacgaactgaaccagctgcttaatgaggccctgctggagcgggagtccgcccag
gtggtaaagaagagaaacacattcctcctgaccatgaggttcatggacccagagatggaa
acacgctactcggtggagaaggagaagcagagcggggctgccttcagctgctcctgtgtg
gtcctcttctgcacggccatggtggagatactcattgacccctggctgatgacaaactat
gtgacctttgtggttggggaggttctgctcctgatcctgaccatctgctcgatggctgcc
atctttcccaggtcatttcccaagaagcttgtggccttctcatcttggattgaccggacc
cgctgggcaaggaacacctgggccatgttagccatcttcattctggttatggccaatgtt
gtggacatgctcagctgtctccagtactacatgggaccttacaacatgacagctgggatg
gagctggacggcggctgcatggagaaccccaagtactacaactacgtagctgtgctgtcg
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctgacgctcatgctg
ctcgtcacaggcgccgtgactgccctcaacctgtacgcctggtgtcctgtctttgatgaa
tacgaccacaagcgctttcaggaaaaggactctcctatggtggccttagagaagatgcag
gtacttgccacccctgggctcaatggcactgacagcaggctgcccctggtgccttccaag
tactccatgactgtgatgatgttcgtcatgatgctgagcttttactacttctcgcgccac
gtggaaaaactggcccgaacactgttcttgtggaagattgaggtccatgaccagaaagaa
cgtgtctacgagatgcgccgatggaacgaggccttggtcaccaacatgttgcctgagcat
gttgcacgccattttctggggtccaagaagagagatgaggagctgtacagccagtcttat
gacgagattggagtcatgtttgcctccttgcccaactttgctgacttctacactgaggag
agcatcaacaacggcggcatcgagtgtctacgcttcctcaatgagatcatctctgatttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaactattggcagc
acctatatggcagcttcaggagtcacaccagatgtcaacaccaatggctttacaagctcc
agcaaggaggagaagtcagacaaggagcgctggcagcacctggctgacctggctgacttt
gcattagccatgaaggacacgctcacaaacatcaacaaccagtcattcaacaacttcatg
ttgcgcataggcatgaacaaaggaggggttctggctggcgtcattggagcccggaaacca
cactatgacatctggggcaatacggtcaatgtggccagcaggatggaatccacaggagtc
atgggcaacatccaggtggtagaagagacgcaggtcatccttcgagagtacggcttccgc
tttgtgaggcgaggtcccatctttgtgaaaggcaaaggggagcttctgacctttttcttg
aaggggcgggacaggccagctgccttccccaatggctcctctgttacactgccccaccaa
gtggtggacaacccctga

KEGG   Mus musculus (mouse): 11512Help
Entry
11512             CDS       T01002                                 

Gene name
Adcy6, AC6, mKIAA0422
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11512 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11512 (Adcy6)
   04371 Apelin signaling pathway
    11512 (Adcy6)
   04072 Phospholipase D signaling pathway
    11512 (Adcy6)
   04024 cAMP signaling pathway
    11512 (Adcy6)
   04022 cGMP-PKG signaling pathway
    11512 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    11512 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    11512 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11512 (Adcy6)
   04062 Chemokine signaling pathway
    11512 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    11512 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    11512 (Adcy6)
   04912 GnRH signaling pathway
    11512 (Adcy6)
   04913 Ovarian steroidogenesis
    11512 (Adcy6)
   04915 Estrogen signaling pathway
    11512 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    11512 (Adcy6)
   04921 Oxytocin signaling pathway
    11512 (Adcy6)
   04926 Relaxin signaling pathway
    11512 (Adcy6)
   04918 Thyroid hormone synthesis
    11512 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    11512 (Adcy6)
   04916 Melanogenesis
    11512 (Adcy6)
   04924 Renin secretion
    11512 (Adcy6)
   04925 Aldosterone synthesis and secretion
    11512 (Adcy6)
   04927 Cortisol synthesis and secretion
    11512 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11512 (Adcy6)
   04270 Vascular smooth muscle contraction
    11512 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    11512 (Adcy6)
   04971 Gastric acid secretion
    11512 (Adcy6)
   04972 Pancreatic secretion
    11512 (Adcy6)
   04976 Bile secretion
    11512 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    11512 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11512 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    11512 (Adcy6)
   04727 GABAergic synapse
    11512 (Adcy6)
   04725 Cholinergic synapse
    11512 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    11512 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    11512 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    11512 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    11512 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    11512 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11512 (Adcy6)
   04714 Thermogenesis
    11512 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11512 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    11512 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    11512 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11512 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11512 (Adcy6)
   05163 Human cytomegalovirus infection
    11512 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    11512 (Adcy6)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     11512 (Adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD DUF5134 Shisa
Motif
Other DBs
NCBI-GeneID: 11512
NCBI-ProteinID: NP_031431
MGI: 87917
Ensembl: ENSMUSG00000022994
UniProt: Q01341 F8VQ52
LinkDB All DBs
Position
15; 15 F1
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRHANRASGFCAPRYMSCLKNAEPPSPTPAAHT
RCPWQDEAFIRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPAQPQPAYVA
LLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNSSDPFLWKQLGANVVLFLCTNAI
GVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAVRENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQCIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLVFPYSTLILGIYAAIFLLLLVTVLICAVCSC
GSFFPKALQRLSRNIVRSRVHSTAVGIFSVLLVFISAIANMFTCNHTPIRTCAARMLNLT
PADVTACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNVLLSLLASSVFLHISSIGKLA
MTFILGFTYLVLLLLGPPAAIFDNYDLLLGVHGLASSNETFDGLDCPAVGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggttcccaaagtggatgaacggaaaacagcttggggg
gaacgcaatgggcagaagcgcccacgccacgcgaatcgagccagtggcttctgcgcacct
cgctacatgagctgcctcaagaatgcggagccacccagccccactcctgcagctcacact
cggtgcccctggcaggatgaagccttcatcaggagggcgggcccgggcaggggtgtggag
ctggggctgcggtcagtggccttggggtttgacgacactgaggtgaccacaccgatgggc
acagctgaagtggcaccggatacatcgcctcggagcggtccgtcctgctggcaccggctt
gtgcaggtgttccagtctaagcagttccgctctgccaagctggagcggctgtaccagcgg
tacttcttccagatgaaccagagcagcctcacgctgctcatggcggtgctggtgctgctc
atggctgtactgttgactttccacgctgcgcctgcccagcctcagcctgcttacgtggcc
ctgctgacctgtgcctctgtcctttttgtggtactcatggtggtgtgtaaccgacacagc
ttccgccaggactccatgtgggtggtgagctatgtggtcctgggcatcctagcagccgtg
caagtcgggggtgccctggcagccaatccacacagcccctcggcgggcctttggtgcccc
gtgttcttcgtctacatcacctacactcttcttcccattcgcatgcgagccgcagtactc
agcggcctgggcctctctactctgcatttgattttggcctggcagctcaacagcagcgac
cccttcctttggaagcagctcggtgctaacgtggtgctcttcctctgcaccaatgccatc
ggtgtctgcacacactaccctgctgaagtgtctcagcgccaagcctttcaggagacccga
ggttacatccaggcgcggctgcacctgcagcatgagaaccgtcagcaggaacggctgctg
ctatcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaaaaaa
gaggacatgatgttccataagatctacatccagaagcatgataatgtcagcatcctgttt
gcggacattgagggcttcaccagcctggcctcccagtgcactgcacaggaactggtcatg
accttgaatgagctctttgcccggtttgacaagctggctgcggtgagggagaatcactgt
ctgaggatcaagatcttaggagactgttactactgcgtgtcagggctgcccgaggcccgg
gcagatcacgcccactgctgtgtggagatgggggtagacatgatcgaagccatctcgctg
gtgcgtgaggtaacaggtgtgaacgtgaacatgcgtgtgggcatccacagcggacgtgtg
cattgcggcgtccttggcctacggaaatggcagtttgatgtctggtcaaacgatgtgacc
ctggctaaccacatggaggccgggggccgggccggccgcatccacatcactcgggctaca
ctgcagtacttgaacggggactatgaggtggagccaggccgtggtggtgaacgcaatgcg
tacctcaaggagcagtgcattgagaccttcctcatacttggcgccagccaaaaacggaaa
gaggagaaagccatgctggccaagcttcagcggacacgggccaactccatggaaggactg
atgccccgctgggttcctgaccgtgccttctcccggaccaaggactctaaggcattccgc
cagatgggcattgatgattctagcaaagacaaccggggtgcccaagatgctctgaaccct
gaagatgaggtggatgagttcctgggccgagccatcgatgcccgaagcatcgaccaactg
cgtaaggaccatgtgcgccggttcctgctcaccttccagagagaggatcttgagaagaag
tattcacggaaagtagatcctcgcttcggagcctacgtcgcctgtgccctcctggttttt
tgcttcatctgttttatccagctccttgtgttcccatactccaccctgatactcgggatt
tatgccgctatcttcctgctgttgctggtcactgtgctgatctgtgccgtgtgctcctgc
ggttctttcttccccaaggccctgcaacgcctgtcccgcaatattgtccgctcacgggtg
cacagcaccgcggttggaatcttctcggttctgcttgtgttcatctctgccatcgccaac
atgtttacctgtaatcacaccccaataaggacctgcgcggcccggatgctgaacttaaca
ccagcggatgtcaccgcctgccacctacaacagctcaattactctctgggactggatgct
cccctgtgtgagggcaccgcacccacctgcagcttccctgagtacttcgtcgggaacgtg
ctgctgagtcttctagccagctctgtcttcctacacatcagcagcatcggcaagctggcc
atgaccttcatcttggggttcacctacttggtgctgcttttgctgggtcccccggccgcc
atctttgacaactatgatctactgcttggcgtccatggcttggcttcctccaatgagacc
tttgatgggctggactgcccagctgtggggagggtagcgctcaaatatatgacccccgtg
attctgctggtgtttgccctggcactgtatctgcatgcacaacaggtggaatcgactgcc
cgcctggacttcctgtggaagttacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggttgctgcataacattcttcccaaggacgtggccgcccacttc
ctggcccgggaacgccgcaacgatgagctgtactaccagtcgtgtgaatgtgtggctgtc
atgtttgcctccatcgccaatttctcggagttctacgtggagctcgaggcaaacaacgag
ggcgtggagtgcctgcggctgctcaatgagatcatcgcagactttgacgagatcatcagt
gaggagagattccggcagttggagaagatcaagaccatcggtagcacctacatggccgcc
tctgggctaaatgccagcacctatgaccaggtcggccgctcacacatcacggcgctggct
gactatgccatgcggctcatggagcagatgaaacacatcaatgaacactctttcaacaat
ttccagatgaagatcgggttgaacatgggtccggttgtagcaggcgtcattggggcccga
aagccacagtatgacatctggggaaataccgtgaatgtttccagtcgtatggacagcact
ggagttcctgaccgaatacaggtgactacggacctataccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggaaagggggagatgaccacctac
ttcctcaacgggggccccagcagttag

KEGG   Mus musculus (mouse): 11513Help
Entry
11513             CDS       T01002                                 

Gene name
Adcy7, AA407758
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11513 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11513 (Adcy7)
   04371 Apelin signaling pathway
    11513 (Adcy7)
   04020 Calcium signaling pathway
    11513 (Adcy7)
   04072 Phospholipase D signaling pathway
    11513 (Adcy7)
   04024 cAMP signaling pathway
    11513 (Adcy7)
   04022 cGMP-PKG signaling pathway
    11513 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    11513 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    11513 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11513 (Adcy7)
   04062 Chemokine signaling pathway
    11513 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    11513 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    11513 (Adcy7)
   04912 GnRH signaling pathway
    11513 (Adcy7)
   04913 Ovarian steroidogenesis
    11513 (Adcy7)
   04915 Estrogen signaling pathway
    11513 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    11513 (Adcy7)
   04921 Oxytocin signaling pathway
    11513 (Adcy7)
   04926 Relaxin signaling pathway
    11513 (Adcy7)
   04918 Thyroid hormone synthesis
    11513 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    11513 (Adcy7)
   04916 Melanogenesis
    11513 (Adcy7)
   04925 Aldosterone synthesis and secretion
    11513 (Adcy7)
   04927 Cortisol synthesis and secretion
    11513 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11513 (Adcy7)
   04270 Vascular smooth muscle contraction
    11513 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    11513 (Adcy7)
   04971 Gastric acid secretion
    11513 (Adcy7)
   04972 Pancreatic secretion
    11513 (Adcy7)
   04976 Bile secretion
    11513 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    11513 (Adcy7)
   04727 GABAergic synapse
    11513 (Adcy7)
   04725 Cholinergic synapse
    11513 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    11513 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11513 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    11513 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    11513 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11513 (Adcy7)
   04714 Thermogenesis
    11513 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11513 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    11513 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    11513 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11513 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11513 (Adcy7)
   05163 Human cytomegalovirus infection
    11513 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    11513 (Adcy7)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     11513 (Adcy7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 11513
NCBI-ProteinID: NP_001032812
MGI: 102891
Ensembl: ENSMUSG00000031659
Vega: OTTMUSG00000061472
UniProt: P51829 Q3U1P1 Q3UU15
LinkDB All DBs
Position
8 C3; 8 43.06 cM
AA seq 1099 aa AA seqDB search
MPAKGRYFLNEGDEGPDQAALYEKYRLTSLHGPLLLLLLLVAAATCIALISIAFSHEDLR
RHQVVLGTAFLMLTLFVALYVLVYVECLVQRWLRALALLTWACLMVLGSVLMWDSLENEA
HAWEQVPFFLFVVFVVYALLPLSRRAAIVAGVTSTVSHLLVFGAVTRAFQTSMSSTQLGL
QLLANAVILLGGNFTGAFHKHQLQDASRDLFIYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKEGGDRHYMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGHGEQRDPYLKEMNIRTYLVIDPRSQQPPPPSHHLSKPKGDATLKM
RASVRVTRYLESWGAARPFAHLNHRESVSSSETPISNGRRQKAIPLRRHRAPDRSASPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREYRLVPIPRARYDFAC
ASLVFVCILLVHLLVMPRMATLGVSFGLVACLLGLVLSFCFATEFSRCFPSRSTLQAISE
SVETQPLVRLVLVVLTVGSLLTVAIINMPLTLNPGPEQPGDNKTSPLAAQNRVGTPCELL
PYYTCSCILGFIACSVFLRMSLELKAMLLTVALVAYLLLFNLSPCWHVSGNSTETNGTQR
TRLLLSDAQSMPSHTLAPGARETAPSPSYLERDLKIMVNFYLILFYATLILLSRQIDYYC
RLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVM
FASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAA
GLSAPSGHENQDLERKHVHIGVLVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAGV
IGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGE
LRTYFVCTDTAKFQGLGLN
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctaaatgagggtgatgaaggccccgaccaggcagcg
ctctatgagaagtaccggctcaccagcttgcacgggccactgctgctcttgctcctcctg
gtggccgcggccacctgcattgcgctcatcagcatcgccttcagtcatgaggatctccgc
agacaccaggttgtcctgggcactgcgttcctcatgctgacgctgtttgtggctctctat
gtgctggtgtatgtcgagtgcctggtgcagcggtggctgcgggccttggcgctactcacc
tgggcttgcctcatggtactaggctccgtgctgatgtgggactctttggagaatgaagcc
catgcgtgggagcaggtgcctttcttcctgtttgtcgtctttgtggtgtatgcactactg
cctctcagcaggagggcagccatcgtggcaggcgtgacctccacggtctcccatctcctg
gtgtttggagctgtgacaagagccttccagacgtccatgtctagcactcaactggggctg
cagctcctggccaatgccgttatcctcctgggtgggaacttcacgggtgccttccacaag
caccagctgcaggacgcgtccagggatctctttatctacaccgtcaaatgcatccagatc
cgtcggaagcttcgtgtggagaagcgccagcaggagaacctgcttctgtcagtgctccca
gcacacatctccatgggtatgaagctggccatcattgagcgcctcaaagagggtggtgac
cgacactacatgcccgacaacaactttcacagcctctatgtcaagcggcaccagaatgtc
agcatcttgtatgcagacatcgtgggcttcacgaggctggccagcgactgctctcccaag
gagctggtggtggtgctcaacgagctgtttgggaagtttgaccagattgctaaggccaat
gagtgcatgcggatcaagatcctgggtgactgttactactgcgtgtcaggcctgcccgtg
tcgctgcccacacatgcccgcaactgtgtgaagatgggtctggacatctgcgaggccatt
aagcaggtgcgtgaggccacgggcgtggacatcagcatgcgtgtgggcattcactccggg
aatgtgctatgtggggtcatcgggctccgtaagtggcagtatgatgtgtggtcccatgat
gtgtccctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagag
gcaacattgaatcacctggacaaggcatatgaggtggaggatgggcatggggagcagcga
gacccctatctgaaagagatgaacatccgaacctacctggtgatcgatccccggagccag
cagccacccccacccagccaccacctctccaagcccaagggggacgcaactctgaagatg
cgggcttcagtgcgtgtaacccgctatctggagtcttggggggcagcaaggccctttgca
cacctcaaccaccgggagagtgtgagcagcagtgagacccccatctccaatggacggagg
cagaaggccattcctctgcgtcgacaccgtgcccctgataggagtgcatctcccaagggg
cgcttggaagatgactgtgatgacgagatgctgtcagccattgagggtctcagctccacc
aggccctgctgctccaagtctgatgacttccacacctttggtcccatcttcttggagaag
ggctttgagcgtgagtaccgcctggtgcccatcccccgggctcgctacgacttcgcctgt
gccagccttgtcttcgtctgcatcctgcttgtccaccttctagtgatgcccaggatggca
actctgggtgtgtcctttgggttggtggcctgcctgctggggctggttctgagtttctgc
tttgctactgagttctcgaggtgctttccatcccgaagtacactccaggccatctcggag
agcgtggagacgcagcccctggtcaggcttgtcctggttgtgctgactgttggcagccta
ctgactgtcgccatcattaacatgccactgacgcttaacccaggcccagagcagcctgga
gacaacaagacaagcccactggctgcacagaacagagttgggaccccatgtgagctcctc
ccgtactacacctgcagctgcatcctgggcttcattgcatgctctgttttcctgcggatg
agcctagagctgaaggccatgctgctgacagtggccttggtggcctacctgctgctcttc
aacctctccccatgctggcacgtctcaggcaacagcactgagaccaacgggacacaaagg
acacggctgctcctgtctgatgcacaaagcatgcccagccacacccttgctccgggggct
cgggagactgccccttctcccagttatttagagagagacctgaagatcatggttaacttc
tacctgatcctgttctatgccaccctcatcttgctgtctagacagattgactactactgc
cgcttggactgtctgtggaagaagaagttcaaaaaggagcacgaggagtttgaaacaatg
gagaatgtgaaccgcctcctcctggagaatgtgctgccggcgcacgtggctgcccacttc
attggggacaaggcagcagaggattggtaccatcaatcttatgactgtgtctgtgtcatg
tttgcatccgttccggacttcaaagtgttctacactgagtgtgatgtcaacaaagaagga
ctggagtgccttcgactgctgaatgagataattgctgattttgacgagctcctgctgaag
cccaagtttagtggtgtggagaagatcaagaccattggcagcacctacatggcggcagca
gggctcagtgccccctcaggacatgagaaccaggacctggagcggaagcacgtgcacatc
ggagtcttggtagaatttagcatggccctgatgagcaagctggatgggatcaacaggcac
tccttcaactccttccgcctccgagtcggcataaaccacgggcctgtgattgctggagtg
attggagcacgcaagcctcagtatgacatctggggaaacacagtcaatgttgccagccgc
atggagagcaccggagagcttgggaaaatccaggttaccgaagagacatgcactatcctc
cagggactcggatattcgtgtgaatgccgtgggctgatcaacgtcaaaggcaaaggggaa
ctgcggacttactttgtatgtacagacactgccaagtttcaagggctggggctaaactga

KEGG   Mus musculus (mouse): 11514Help
Entry
11514             CDS       T01002                                 

Gene name
Adcy8, AC8, AW060868
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11514 (Adcy8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11514 (Adcy8)
   04371 Apelin signaling pathway
    11514 (Adcy8)
   04020 Calcium signaling pathway
    11514 (Adcy8)
   04072 Phospholipase D signaling pathway
    11514 (Adcy8)
   04024 cAMP signaling pathway
    11514 (Adcy8)
   04022 cGMP-PKG signaling pathway
    11514 (Adcy8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    11514 (Adcy8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    11514 (Adcy8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11514 (Adcy8)
   04062 Chemokine signaling pathway
    11514 (Adcy8)
  09152 Endocrine system
   04911 Insulin secretion
    11514 (Adcy8)
   04923 Regulation of lipolysis in adipocytes
    11514 (Adcy8)
   04912 GnRH signaling pathway
    11514 (Adcy8)
   04913 Ovarian steroidogenesis
    11514 (Adcy8)
   04915 Estrogen signaling pathway
    11514 (Adcy8)
   04914 Progesterone-mediated oocyte maturation
    11514 (Adcy8)
   04921 Oxytocin signaling pathway
    11514 (Adcy8)
   04926 Relaxin signaling pathway
    11514 (Adcy8)
   04918 Thyroid hormone synthesis
    11514 (Adcy8)
   04928 Parathyroid hormone synthesis, secretion and action
    11514 (Adcy8)
   04916 Melanogenesis
    11514 (Adcy8)
   04925 Aldosterone synthesis and secretion
    11514 (Adcy8)
   04927 Cortisol synthesis and secretion
    11514 (Adcy8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11514 (Adcy8)
   04270 Vascular smooth muscle contraction
    11514 (Adcy8)
  09154 Digestive system
   04970 Salivary secretion
    11514 (Adcy8)
   04971 Gastric acid secretion
    11514 (Adcy8)
   04972 Pancreatic secretion
    11514 (Adcy8)
   04976 Bile secretion
    11514 (Adcy8)
  09156 Nervous system
   04724 Glutamatergic synapse
    11514 (Adcy8)
   04727 GABAergic synapse
    11514 (Adcy8)
   04725 Cholinergic synapse
    11514 (Adcy8)
   04720 Long-term potentiation
    11514 (Adcy8)
   04723 Retrograde endocannabinoid signaling
    11514 (Adcy8)
  09157 Sensory system
   04742 Taste transduction
    11514 (Adcy8)
   04750 Inflammatory mediator regulation of TRP channels
    11514 (Adcy8)
  09149 Aging
   04211 Longevity regulating pathway
    11514 (Adcy8)
   04213 Longevity regulating pathway - multiple species
    11514 (Adcy8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11514 (Adcy8)
   04714 Thermogenesis
    11514 (Adcy8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11514 (Adcy8)
  09165 Substance dependence
   05032 Morphine addiction
    11514 (Adcy8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    11514 (Adcy8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11514 (Adcy8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11514 (Adcy8)
   05163 Human cytomegalovirus infection
    11514 (Adcy8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    11514 (Adcy8)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     11514 (Adcy8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 11514
NCBI-ProteinID: NP_033753
MGI: 1341110
Ensembl: ENSMUSG00000022376
UniProt: P97490 Q3UUN2
LinkDB All DBs
Position
15 D1; 15 29.03 cM
AA seq 1249 aa AA seqDB search
MELSDVHCLSGSEELYTIQPTPPAGDDGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GVSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGPGERAHNTGGTKVFPERSGSGSASGSG
GGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSE
VVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDNTSHTYL
QYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLL
QVTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLR
LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKG
FTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCC
VEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLES
GGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLCLPEDIV
KESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQS
GPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIV
LLFITAIQSLLPSSRLMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINETY
LARNVIIFASILINFLGAVLNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVL
AMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEASL
LLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARH
FLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELL
GEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF
NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKD
QGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQS
LNRQRQKQLLNENSNSGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcggatgtgcactgccttagtggcagcgaggaactctacaccatccaaccg
acgcccccggccggcgacgacgggagcggctctcggccgcagcggctgctgtggcagacg
gcggtgcggcacatcacggagcagcgcttcatccacgggcaccgaggcggcggcggcggc
ggggtctcccgcaaagcctcgaaccctgcgggcagtggacccaatcaccacgcgccgcag
ctgtctagcgactcggtgctgcctctctattctctgggccccggagagcgagcgcacaac
accggtggcaccaaagtctttccggaacgcagcgggagcggcagtgccagtggcagcggg
ggcgggggcgacttgggcttcctacaccttgactgtgccccaagtaactcggatttcttc
ctcaatggaggatacagctaccgaggggtcatttttccaaccctacgcaactccttcaag
tctcgggatctggagcgcctctaccaacgctatttcctgggccagaggcgcaaatcggag
gtagtgatgaacgtgttggatgtactaaccaaactcacccttttagtcctgcacttgagc
ctggcctcggctccaatggaccctctcaagggcatcctgctaggctttttcactggcatc
gaggtggtgatctgcgccctcgtggtggtcaggaaggacaacacctcccacacttacctg
caatacagcggcgtggtcacttgggtggctatgaccacccagattctggcagcaggcctg
ggctatgggcttctgggcgacggcataggctacgtgctttttacactcttcgccacctac
agcatgcttcccctgcctctcacctgggccatcttggccggcctgggcacatctttgctg
caagtcacccttcaagtactcatacccaggctagcggtcttttccatcaaccaggtcctg
gcccaggtggtgctattcatgtgtatgaatacagcaggaatcttcatcagttacctttca
gaccgtgcccagcgccaggccttcctggagacccggaggtgtgtggaggccaggctccgc
ttggagacagagaaccaaagacaggagcggcttgtgctgtctgtgctccccaggtttgtc
gtcctggaaatgatcaacgacatgaccaatgtggaggatgagcacctgcagcatcagttc
caccgcatctacatccatcgctatgagaacgtcagtattctttttgcagatgtcaaagga
tttaccaacctctctacgaccttgtctgctcaggagctggtcaggatgctcaacgaactc
tttgccagattcgaccggctggcccatgagcatcactgtcttcgcattaaaatcctgggg
gactgctactactgtgtgtctggactgcctgagccccgccgggaccacgctcattgctgt
gttgaaatgggcctcagcatgatcaaaactatcaggtttgtgagatccagaacgaagcac
gatgttgacatgcgaattggaatccattcaggttctgtgctatgtggtgtgttgggcctg
aggaaatggcagtttgatgtctggtcttgggatgtggacatagcaaacaagcttgagtct
ggaggaatccctgggaggattcacatttctaaagccaccctggattgcctcaatggtgac
tataacgtggaagagggtcacgggaaagagaggaacgaattcttgaggaagcataacata
gagacctatttgattaagcagcctgaggagagtttgctctgcttgcctgaagacatcgtt
aaggagtcggtgagctgctctgacaggagaaacagtggagcaacattcacagaaggatcg
tggagcccagagctgcctttcgacaacatcgtgggcaaacagaatactctggctgcccta
acaagaaattcaataaatctgcttccaaaccatctcgcacaagctttgcatgtccagtct
gggcctgaggaaattaacaagagaatagagcataccatcgacttgcggagtggcgataag
ttgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctggagcac
aagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgcatttatcgtt
cttctgtttatcactgcaattcaaagtttgcttccttcttcaaggctgatgcctatgact
atccagttctccatcctgatcatgctgcactctgccctggtcctcatcaccacagcagaa
gactataagtgtctgcccctcatcctccgaaaaacctgctgttggattaatgagacctat
ctggcccgcaacgtcatcatcttcgcttccatcttaattaacttcctgggagctgtccta
aatattctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttcaattcc
tcagctgtgtttacagatatctgctcctacccagagtactttgtcttcactggggtgttg
gccatggtgacctgtgctgtgtttctacggcttaactctgtcctgaagctggcagtgcta
ctcatcatgatcgccatctacgccctgctcacagagaccatctacgcaggtctctttctg
agttatgacaacctgaaccacagtggagaagatttcctggggaccaaggaagcatcactg
ctgctgatggccatgttccttcttgctgtgttctaccatggacaacagctggagtacaca
gcccgcctggatttcctgtggcgcgtacaggccaaagaggagatcaacgagatgaaggaa
ctgagggaacacaacgagaacatgctgcgcaatatcttacccagccatgtggcccgccac
ttcctggagaaagacagagacaatgaggagctgtattctcaatcctacgatgctgttgga
gtgatgttcgcctccatccctgggttcgcagacttctactctcagacagaaatgaacaac
cagggagtagaatgtctgcgcttgctgaatgagatcattgctgactttgatgagctgctc
ggggaggaccggtttcaggacattgagaagattaagaccattggtagtacatacatggct
gtctcaggactgtccccagagaaacagcaatgtgaagataaatggggacatttgtgtgcc
ctggctgacttctctcttgctctgactgaaagcatacaagagatcaacaagcattcattc
aacaattttgaactccgaatcggcatcagccatggctcagtggtggcaggtgtaattgga
gctaagaaaccacagtatgacatttgggggaaaactgtgaacttggcaagccgaatggac
agcacgggagtaagtggccggatccaagttcctgaggagacctaccttatcctgaaggac
cagggctttgcctttgactaccgtggggagatatatgtgaagggcatcagtgaacaagaa
gggaaaatcaaaacatactttctcctgggacgagtccaacccaacccattcatcttaccc
ccaaggagacttcccgggcaatactctctggctgcggttgtccttggccttgtccagtct
ctcaacaggcaaaggcagaagcaacttctcaacgagaacagcaattcgggcatcatcaag
agccattacaaccggcggactttgctaacgccaagtgggccagagcctggagcacaagct
gaaggcactgacaaatccgatttgccataa

KEGG   Mus musculus (mouse): 11515Help
Entry
11515             CDS       T01002                                 

Gene name
Adcy9, AC9, ACtp10, AW125421, D16Wsu65e, mKIAA0520
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11515 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11515 (Adcy9)
   04371 Apelin signaling pathway
    11515 (Adcy9)
   04020 Calcium signaling pathway
    11515 (Adcy9)
   04072 Phospholipase D signaling pathway
    11515 (Adcy9)
   04024 cAMP signaling pathway
    11515 (Adcy9)
   04022 cGMP-PKG signaling pathway
    11515 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    11515 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    11515 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11515 (Adcy9)
   04062 Chemokine signaling pathway
    11515 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    11515 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    11515 (Adcy9)
   04912 GnRH signaling pathway
    11515 (Adcy9)
   04913 Ovarian steroidogenesis
    11515 (Adcy9)
   04915 Estrogen signaling pathway
    11515 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    11515 (Adcy9)
   04921 Oxytocin signaling pathway
    11515 (Adcy9)
   04926 Relaxin signaling pathway
    11515 (Adcy9)
   04918 Thyroid hormone synthesis
    11515 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    11515 (Adcy9)
   04916 Melanogenesis
    11515 (Adcy9)
   04925 Aldosterone synthesis and secretion
    11515 (Adcy9)
   04927 Cortisol synthesis and secretion
    11515 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11515 (Adcy9)
   04270 Vascular smooth muscle contraction
    11515 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    11515 (Adcy9)
   04971 Gastric acid secretion
    11515 (Adcy9)
   04972 Pancreatic secretion
    11515 (Adcy9)
   04976 Bile secretion
    11515 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    11515 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11515 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    11515 (Adcy9)
   04727 GABAergic synapse
    11515 (Adcy9)
   04725 Cholinergic synapse
    11515 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    11515 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11515 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    11515 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    11515 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    11515 (Adcy9)
   04714 Thermogenesis
    11515 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11515 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    11515 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    11515 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11515 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11515 (Adcy9)
   05163 Human cytomegalovirus infection
    11515 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    11515 (Adcy9)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     11515 (Adcy9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Motif
Other DBs
NCBI-GeneID: 11515
NCBI-ProteinID: NP_033754
MGI: 108450
Ensembl: ENSMUSG00000005580
Vega: OTTMUSG00000027177
UniProt: P51830
LinkDB All DBs
Position
16 A1; 16 2.42 cM
AA seq 1353 aa AA seqDB search
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKHCKYSISSSCSSSGDS
GGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSMNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFAVHMKSKVIVMVVPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLSGRVDSSNHTLTATPADTCLSQVGSFSICIEVLLLLYTVMQL
PLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGALHWELLSRALLHVCIHAIGIHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEVIDDSRES
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGTVQNGCQDEPKT
STKASGGPNSKTQNGLLSPPAEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGATATPPPPAALAVFGADLLLEVLSLIVSIR
MVFFLEDVMTCTKWLLEWIAGWLPRHCIGAILVSLPALAVYSHITSEFETNIHVTMFTGS
AVLVAVVHYCNFCQLSSWMRSSLATIVGAGLLLLLHISLCQDSSIVMSPLDSAQNFSAQR
NPCNSSVLQDGRRPASLIGKELILTFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYSDKASLGSDDSTQAKEARLSSKRSWREPVKAEE
RFPFGKAIEKDSCEDIGVEEASELSKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaccccaccagcagctgctgcatcaccatagcaccgaggtgagctgcgac
tcaagcggagacagcaacagcgtgagggtcaagatcaaccctaagcagctgtcctccaac
acccacccgaagcactgcaagtacagcatctcctccagctgtagcagctcgggagactca
gggggccttccccggagggttggcggcgggggtcgcctgcgcagacagaagaagctgccc
cagctttttgagagggcctccagccggtggtgggaccccaaattcgactccatgaacctg
gaggaggcctgcctggagcgctgctttccgcagacccagcgccgcttccggtacgcactc
ttttatgtgggcttcgcctgccttctctggagcatctatttcgctgtccacatgaaatcc
aaagtgattgtcatggtggtcccagctctgtgcttcctggtggtgtgtgtgggctttttc
ctgtttactttcaccaagctgtacgcccggcattatgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagtttcaggtttggacacctctgtcagga
cgtgttgacagctccaatcatactctcacggccactccggcggacacttgcttatctcaa
gtaggaagcttctccatatgcatcgaagtgctccttttgctctacacagtcatgcagtta
cctctgtacctgagcttgtttttgggggtggtctattctgtcctttttgagaccttcggc
taccacttccgaaacgaagactgctacccttctccgggccctggggccctgcactgggag
ctgctgagcagagccctgcttcacgtgtgcattcacgctatcgggatccatctgtttgtc
atgtctcaggtgaggtccaggagcacctttctcaaggtgggacaatccattatgcacggc
aaagatctggaagtagagaaagccctgaaagagaggatgattcattcagtgatgccaaga
atcatagccgacgacttaatgaaacaaggggacgaggagagtgagaattccgtcaagagg
catgccacctccagtcccaagaacaggaagaagaagtcctccatacagaaggcaccgata
gcattccgcccctttaagatgcagcagattgaagaagtcagtattttatttgcagacatt
gtgggtttcaccaagatgagcgccaacaaatctgcgcatgccttggtaggcctactcaat
gacctgttcggtcgctttgaccgcctgtgtgagcagaccaagtgtgagaagatcagcact
ctgggggactgttattactgtgtggcagggtgtccggagccccgggcagaccatgcctac
tgctgcattgaaatgggcttaggcatgataaaagccatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgtgttggggttcacacggggactgtcctgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacttggctaatctcatg
gagcagctgggagtggctggcaaagttcacatatctgaggccactgcaaaatacttagac
gacaggtatgaaatggaagatgggagagttattgagcgccttgggcagagtgtggtggct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtcccac
tgcagctgtgcagaggccctgctttctggctttgaggtcattgacgactcacgggagtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgatttggcgcagact
gtcaaaacctttgataaccttaagacttgcccttcttgtggaatcacatttgctcccaaa
tctgaagctggtgcagaaggaggaactgtgcaaaatggctgtcaagacgagcctaagacc
agcaccaaggcttctggaggacccaactccaaaacccagaatggacttctgagccctcct
gcagaggagaagctcactaacagccagacctccctctgtgagatcctgcaagagaaggga
cggtgggcaggggtgagcttggaccagtcagccctcctcccgctcaggttcaagaacatc
cgtgagaaaactgatgcccactttgttgatgtcatcaaagaagacagcctgatgaaagat
tatttcttcaagccgcccatcaatcagttcagcctgaacttcctggaccaggagctggag
cgatcatatagaaccagctaccaggaagaggtcataaagaattctcctgtgaagacgttc
gccagtgccaccttcagctcccttctggatgtgtttctgtcaaccaccgtgttcttgatt
ctctccatcacctgcttcctaaagtatggagccaccgccacccctcccccaccggctgcc
ctggccgtctttggtgcagacctgctgctggaggtgctttccctcatagtgtccatcaga
atggtgtttttcctagaggatgtcatgacatgcacaaagtggttgctggaatggatcgct
ggctggctccctcgccactgcattggggcaatcttggtgtctcttcctgccctggctgtc
tattcacacatcacctctgagtttgagaccaacatacatgttaccatgttcactggctct
gcggtgctggtggccgttgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctcccttgccaccatcgtgggggctgggctgctgcttctgctccacatctccctgtgt
caggacagttccattgtgatgtcccccttggactcagcacagaatttcagtgcccagagg
aacccatgcaacagctcagtgctgcaggacggcaggaggccggccagcctcataggcaag
gagcttatcctcaccttcttcctcctgctcctcttggtctggttcctgaaccgggagttc
gaggtcagctaccggctgcactaccatggggatgtggaggccgacctacaccgcaccaag
atccagagcatgagagaccaggctgactggctactgcggaacatcatcccctaccatgtg
gctgagcagctcaaggtctctcagacctactccaagaaccatgacagcgggggagtcatc
tttgccagcattgtcaacttcagtgaattctatgaggagaactatgaggggggcaaggag
tgctaccgtgtcctcaacgagctgatcggtgacttcgatgagctcttgagcaagccggac
tataatagcatcgagaagatcaagaccatcggggccacatacatggcagcctcagggctg
aacacggcccagtgtcaggagggtggccacccacaggagcatctgcgtatcctcttcgag
ttcgccaaggagatgatgcgcgtggtggatgacttcaacaacaatatgttatggttcaac
ttcaagctcagggtcggctttaaccacggacccctcacagcaggtgtcataggtaccacc
aagctgctgtatgacatctggggggacaccgtcaacatcgccagcaggatggacaccact
ggtgtggagtgccgtatccaggtgagcgaagagagctaccgtgtgctgagcaagatgggt
tatgactttgactaccgagggaccgtgaatgtcaaggggaaagggcagatgaagacctac
ctttacccaaagtgcacggacaatggagtggttccccagcaccagctgtccatctcccca
gacatccgagtccaggtggacggcagcattgggcggtctcccacagatgagattgccaac
ttggtgccttccgttcagtattcggacaaggcttccctgggatctgatgatagcacacag
gctaaggaagctcgcctgtcctctaagaggtcctggagagagccagtcaaagcagaggaa
aggtttccatttggcaaagccatagaaaaggacagctgtgaagacataggagtagaagag
gccagtgaactcagcaagctcaatgtctcaaagagtgtgtga

KEGG   Mus musculus (mouse): 210044Help
Entry
210044            CDS       T01002                                 

Gene name
Adcy2, mKIAA1060
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    210044 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    210044 (Adcy2)
   04371 Apelin signaling pathway
    210044 (Adcy2)
   04020 Calcium signaling pathway
    210044 (Adcy2)
   04072 Phospholipase D signaling pathway
    210044 (Adcy2)
   04024 cAMP signaling pathway
    210044 (Adcy2)
   04022 cGMP-PKG signaling pathway
    210044 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    210044 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    210044 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    210044 (Adcy2)
   04062 Chemokine signaling pathway
    210044 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    210044 (Adcy2)
   04922 Glucagon signaling pathway
    210044 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    210044 (Adcy2)
   04912 GnRH signaling pathway
    210044 (Adcy2)
   04913 Ovarian steroidogenesis
    210044 (Adcy2)
   04915 Estrogen signaling pathway
    210044 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    210044 (Adcy2)
   04921 Oxytocin signaling pathway
    210044 (Adcy2)
   04926 Relaxin signaling pathway
    210044 (Adcy2)
   04918 Thyroid hormone synthesis
    210044 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    210044 (Adcy2)
   04916 Melanogenesis
    210044 (Adcy2)
   04925 Aldosterone synthesis and secretion
    210044 (Adcy2)
   04927 Cortisol synthesis and secretion
    210044 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    210044 (Adcy2)
   04270 Vascular smooth muscle contraction
    210044 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    210044 (Adcy2)
   04971 Gastric acid secretion
    210044 (Adcy2)
   04972 Pancreatic secretion
    210044 (Adcy2)
   04976 Bile secretion
    210044 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    210044 (Adcy2)
   04727 GABAergic synapse
    210044 (Adcy2)
   04725 Cholinergic synapse
    210044 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    210044 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    210044 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    210044 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    210044 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    210044 (Adcy2)
   04714 Thermogenesis
    210044 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    210044 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    210044 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    210044 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    210044 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    210044 (Adcy2)
   05163 Human cytomegalovirus infection
    210044 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    210044 (Adcy2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     210044 (Adcy2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA DUF349
Motif
Other DBs
NCBI-GeneID: 210044
NCBI-ProteinID: NP_705762
MGI: 99676
Ensembl: ENSMUSG00000021536
UniProt: Q3V1Q3
LinkDB All DBs
Position
13 B3; 13 35.55 cM
AA seq 1095 aa AA seqDB search
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMG
ACLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWIC
LVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVY
LSATPGAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFE
KRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADI
VGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAK
NCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
EAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHL
FRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQ
NRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLFFYNKNIEKEYRATA
LPAFKYYVTCACLIFLCIFIVQILVLPKTSILGFSFGAAFLSLIFILFVCFAGQLLQCSK
KASASLLWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANASN
ANVSVPDNQTAILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNII
LLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKN
KFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDF
KEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPS
QEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFV
NTEMSRSLSQSNLAS
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcggcgccgctacctgcgggaccgcgccgaggcggcggca
gcagcggcggcgggcggcggcgaggggctgcagcggtcccgggactggctctacgagtcc
tactactgcatgagccagcagcaccctctcatcgtcttcctgctgctcatcgtcatgggc
gcctgcctcgccctgctcgccgtcttcttcgcgctcgggctggaggtagaagaccatgtg
gcatttttaataaccgttcccactgccctggccatcttcttcgccatattcattcttgtc
tgcattgagtctgtgttcaagaagcttctccgagtgttctcgctggtgatctggatatgt
ctggttgccatgggatacctgttcatgtgctttggagggaccgtgtctgcctgggaccag
gtgtcattcttcctcttcatcatcttcgtggtgtacaccatgcttcccttcaacatgagg
gatgccatcatcgccagcgtcctcacctcttcatctcatacgatagtgctgagtgtctac
ctgtctgcaacaccaggggccaaggagcacctgttctggcagatactggccaacgtgatc
attttcatctgtgggaacttggcgggagcttaccataagcacctcatggaacttgccctg
cagcaaacctatcgggacacatgtaattgcatcaagtcccggatcaagctggaatttgaa
aaacggcagcaggaacgacttctgctttccctgctgcctgctcacattgccatggaaatg
aaggctgaaatcattcaaaggctacagggacccaaagcaggacagatggaaaacacgaac
aacttccacaacctgtatgtcaagcgacacaccaacgtgagcatattatatgctgacatt
gttggcttcacccgccttgcaagcgattgctcccctggtgaactggtccacatgctgaat
gaactctttgggaagtttgatcaaattgcaaaggagaatgagtgcatgagaattaaaatt
ttaggagactgctattactgtgtttccgggctcccgatatctctccctaaccatgccaag
aactgtgtgaaaatgggactggatatgtgcgaagccataaagaaagtgagggatgctact
ggggtcgatatcaacatgcgcgtgggagtgcattctgggaacgttctctgtggtgtgatt
ggtctccagaagtggcagtatgacgtgtggtctcatgatgttactttggccaaccacatg
gaagctggaggagtccctggacgtgttcacatttcctcagtcactctggagcacttgaat
ggggcttataaagtggaggaaggagacggtgagataagagacccatatttaaagcagcat
ttggtgaaaacctactttgtaatcaaccccaagggagaaagacggagtcctcagcatctc
ttcagacctcgacacactctggatggagccaagatgagagcatctgtccgcatgacccgg
tacttggagtcctggggagcagccaagccatttgcacatctgcaccacagagatagcatg
accacagagaatgggaagattagcaccacggatgtgccaatgggtcaacataattttcaa
aatcgcaccttaagaactaagtcacagaagaagcgattcgaagaagaactgaatgaaagg
atgatccaagcaattgacgggatcaacgcacaaaagcaatggctcaagtcagaagacatt
caaagaatctccctgtttttctataacaaaaatatagaaaaagaatatcgagccactgca
ctgccagcattcaagtactacgtgacctgtgcctgcctcatcttcctctgtatcttcatt
gtacagattcttgtactgccaaaaacgtccatccttggcttctcctttggagctgcattt
ctctccctcatcttcatcctctttgtctgcttcgctggacagcttttgcaatgcagcaaa
aaggcctctgcctctctcttgtggcttttgaaatcatcaggcatcatagccaaccgccca
tggccacggatctccctcacgatcgtcaccacagctatcatactaaccatggctgtgttt
aacatgtttttcctgagcaactctgaggagacaacccttccgactgccaatgcatctaat
gcaaacgtttctgtcccagacaaccagacagcaattcttcatgcacgaaacttgtttttc
ctcccgtacttcatatacagctgcattctgggtttgatctcctgctccgttttcctgagg
gtgaactacgagttgaaaatgttaatcatgatggtggcactcgtgggctacaacatcatt
ctgctccacacccatgcccatgtcctggatgcatacagccaggtcctgtttcagagacca
ggcatttggaaagacctgaagaccatgggctctgtgtccctctctatattcttcatcacg
ctgctcgttctgggtagacagagtgaatattactgtaggttagacttcttgtggaagaac
aagttcaaaaaagagcgggaggagatcgaaaccatggagaacctaaaccgagtgctgctg
gagaacgtgctacctgcacacgtggctgaacacttcctggccaggagcctgaaaaacgag
gagttgtaccaccagtcctacgattgtgtctgtgtcatgtttgcctccattccggacttc
aaggaattctacacggagtcagatgtgaacaaggaaggcttggaatgcctccggctcctg
aatgagatcatcgctgactttgatgatctgctttccaagccgaagttcagtggcgttgaa
aagatcaagaccattggtagcacatacatggcagccacgggtctgagtgctgtacccagt
caggagcacgcccaggaacccgagcgtcaatacatgcacataggcaccatggtggagttt
gcatacgccctggtggggaaactggatgccatcaataagcactccttcaacgacttcaaa
cttcgagtgggtatcaaccatggacctgtaatagctggcgtcataggggctcagaagcca
caatatgacatctggggcaacactgtcaacgtcgctagtaggatggacagcaccggagtc
ctggacaaaatacaggtgactgaggagacaagcctcatcctgcagacgcttggctacacg
tgtacatgtcgaggtatcatcaacgtgaaggggaaaggggacctgaagacgtactttgta
aacaccgagatgtcacggtccctttctcagagcaacttggcttcctga

KEGG   Mus musculus (mouse): 224129Help
Entry
224129            CDS       T01002                                 

Gene name
Adcy5, AW121902, Ac5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    224129 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    224129 (Adcy5)
   04371 Apelin signaling pathway
    224129 (Adcy5)
   04072 Phospholipase D signaling pathway
    224129 (Adcy5)
   04024 cAMP signaling pathway
    224129 (Adcy5)
   04022 cGMP-PKG signaling pathway
    224129 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    224129 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    224129 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    224129 (Adcy5)
   04062 Chemokine signaling pathway
    224129 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    224129 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    224129 (Adcy5)
   04912 GnRH signaling pathway
    224129 (Adcy5)
   04913 Ovarian steroidogenesis
    224129 (Adcy5)
   04915 Estrogen signaling pathway
    224129 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    224129 (Adcy5)
   04921 Oxytocin signaling pathway
    224129 (Adcy5)
   04926 Relaxin signaling pathway
    224129 (Adcy5)
   04918 Thyroid hormone synthesis
    224129 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    224129 (Adcy5)
   04916 Melanogenesis
    224129 (Adcy5)
   04924 Renin secretion
    224129 (Adcy5)
   04925 Aldosterone synthesis and secretion
    224129 (Adcy5)
   04927 Cortisol synthesis and secretion
    224129 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    224129 (Adcy5)
   04270 Vascular smooth muscle contraction
    224129 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    224129 (Adcy5)
   04971 Gastric acid secretion
    224129 (Adcy5)
   04972 Pancreatic secretion
    224129 (Adcy5)
   04976 Bile secretion
    224129 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    224129 (Adcy5)
   04727 GABAergic synapse
    224129 (Adcy5)
   04725 Cholinergic synapse
    224129 (Adcy5)
   04728 Dopaminergic synapse
    224129 (Adcy5)
   04726 Serotonergic synapse
    224129 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    224129 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    224129 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    224129 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    224129 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    224129 (Adcy5)
   04714 Thermogenesis
    224129 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    224129 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    224129 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    224129 (Adcy5)
   05031 Amphetamine addiction
    224129 (Adcy5)
   05032 Morphine addiction
    224129 (Adcy5)
   05034 Alcoholism
    224129 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    224129 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    224129 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224129 (Adcy5)
   05163 Human cytomegalovirus infection
    224129 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    224129 (Adcy5)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     224129 (Adcy5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 224129
NCBI-ProteinID: NP_001012783
MGI: 99673
Ensembl: ENSMUSG00000022840
UniProt: P84309
LinkDB All DBs
Position
16; 16 B3
AA seq 1262 aa AA seqDB search
MSGSKSVSPPGYAAQTAASPAPRGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAGGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVELGLEERRGKGRAAEELEPGTGI
VEDGDGSEDGGSSVASGSGTGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQIAYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNSQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGDRNAYLKEHSIETFLILSCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSLFMLSFYLSCFLLLALVVFVSVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGS
PQPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIEFIYVLIVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKAGKTHIKAIADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcggcgtcgcca
gcgccccggggaggcccggagcatcgcgccgcttggggagaagccgattcccgcgccaat
ggctacccccacgcccccgggggatcaacccgcggctccaccaagagatctgggggagcg
gtgaccccacaacagcagcagcgcctggccagccgttggcgcggtggcgatgacgacgaa
gaccctccactaagcggtgatgaccctctggctgggggcttcggcttcagcttccgctct
aagtccgcctggcaggagcgcggtggcgacgacggcggtcgcggcagcaggcggcagcgg
cggggcgcggctggagggggcagcacccgggcgccccctgcgggcggcagcggcagttcg
gcggcggccgcagcggccgcaggtggcacagaggtgcgcccccgctcggtggagctgggc
ctggaggagcgtcgaggaaaaggccgagcggccgaggagctggagcccgggactggcatc
gtcgaggatggagacgggtcggaggatggaggcagttctgtggcgtcaggctctgggacc
ggcgcggtgctgtcgttgggcgcctgctgcctggccttgctgcagatattccgctctaag
aagttcccgtcggacaaactggagcgtctgtaccagcgctacttcttccgcctgaaccag
agcagtctcaccatgctcatggccgtgctggtgcttgtgtgcctggtcatgctggctttc
cacgcggcgcgccccccgctccagatagcctacctggccgtgttggcagctgctgtgggc
gtgatccttatcatggccgtgctctgcaaccgtgcagcgttccaccaggaccacatgggc
ctggcctgctatgcgctcattgcagtggtgctggccgtccaggtagtgggcctgttgctg
ccacagccacgcagcgcctccgagggcatctggtggaccgtgttcttcatctataccatc
tacaccctgctgcctgtgcgcatgagggctgcggtgctcagcggggtgcttctgtcggct
ctccacttggccatctctctgcacaccaactcccaggaccagtttctgctgaaacagctt
gtctccaatgtcctcatcttctcctgcaccaacattgtgggtgtgtgcactcactaccca
gctgaggtctcccagagacaggccttccaggagacccgggagtgtatccaggctcggctc
cattcccagcgggagaaccagcaacaggagcgtctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccacaag
atctacatccagaagcatgacaatgtgagcatcctgtttgctgacatcgagggcttcacc
agcctggcttcccagtgtactgcccaagaactggtcatgaccctcaatgagctcttcgcc
cgctttgacaagttggctgcggagaatcactgtttacggattaagatcctcggggattgt
tactactgcgtctcggggctgcctgaagccagagccgaccatgcccactgctgcgtggag
atgggaatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgcgtgggaattcacagcgggagagtacactgcggtgtccttggtctcagaaag
tggcaattcgacgtgtggtctaacgatgtcactctggccaaccacatggaagctggtggc
aaggcgggccgcatccacatcaccaaggccacactcaactacctgaatggggactatgag
gtggaaccaggctgtggtggcgatcgcaatgcctacctcaaggagcacagcattgagacc
ttcctcatcctgagctgtacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcggacacaatccgcctcactggggagccgagcgcccc
ttctacaaccacttgggcggcaaccaggtgtcaaaggagatgaagaggatgggctttgag
gaccccaaggacaagaatgcccaggaaagtgcgaacccagaggatgaagtggacgagttt
ctgggtcgggccatcgatgccaggagcatcgacagactgcgatctgaacacgtccgcaag
ttcctcctgaccttcagggagcccgacttagagaagaagtactccaagcaggtggatgac
cgatttggtgcctatgtggcctgcgcctcgcttgttttcctcttcatctgctttgtccag
atcaccattgtgccccactccctgttcatgctgagtttctacctgtcgtgtttcctgctg
ctggccttggtggtgtttgtgtctgtgatctatgcctgtgtgaagcttttccccactccc
ctgcagacactctccaggaagatagtgcgatccaagaagaacagcaccctggtcggggta
ttcaccatcaccctggtgttcctctcggcttttgtcaacatgttcatgtgcaactctaag
aacctggtgggctgcctggcagaggagcacaacatcacggtgaaccaggtcaacgcatgt
catgtgatggagtcggccttcaactacagcctgggcgacgagcagggcttctgtggcagc
ccccagcccaactgcaacttcccagagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcattggaaagctggtgctcatgctggccatt
gagttcatctatgtgctcatcgtggaggtgcccggcgtcacactcttcgacaacgctgac
cttctggtcaccgccaatgccatagacttcagcaacaacgggacctcccagtgccctgag
catgcaaccaaggtggcgctgaaggtggtgacgcccatcatcatctctgtcttcgtgctg
gctctgtatctgcatgcccagcaggtggagtccactgctcgccttgacttcctctggaaa
ctgcaggccacagaagagaaggaggagatggaggagctgcaggcctacaatcggcgcctg
ctgcacaacattctgcccaaggacgtggctgcccacttcctggcccgggaacggcgcaat
gacgagctgtactaccaatcgtgcgagtgtgtggctgtcatgtttgcctccattgccaac
ttctccgaattctatgtagagctagaggccaacaatgagggcgtcgagtgcctacggctg
ctcaatgagatcatcgcagacttcgatgagatcatcagtgaggatcggttcaggcagctg
gaaaagatcaagaccataggcagcacctacatggctgcctctggcctcaacgactccacc
tatgacaaggcaggcaagacccacatcaaggctattgcagacttcgctatgaagctgatg
gaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagattgggctc
aacattggacctgtagtggctggagtcattggggctcgcaagcctcagtatgacatctgg
ggcaatacagtgaatgtggccagccgtatggacagcactggggtgcctgaccgcatccag
gttactacagatatgtaccaggtgctggccgccaacacataccagctggagtgccggggt
gtggtcaaggtcaagggcaagggtgagatgatgacttacttcctcaatggagggcctccc
ctcagttag

KEGG   Mus musculus (mouse): 432530Help
Entry
432530            CDS       T01002                                 

Gene name
Adcy1, AC1, D11Bwg1392e, I-AC, brl
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05142  Chagas disease (American trypanosomiasis)
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    432530 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    432530 (Adcy1)
   04371 Apelin signaling pathway
    432530 (Adcy1)
   04020 Calcium signaling pathway
    432530 (Adcy1)
   04072 Phospholipase D signaling pathway
    432530 (Adcy1)
   04024 cAMP signaling pathway
    432530 (Adcy1)
   04022 cGMP-PKG signaling pathway
    432530 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    432530 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    432530 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    432530 (Adcy1)
   04062 Chemokine signaling pathway
    432530 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    432530 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    432530 (Adcy1)
   04912 GnRH signaling pathway
    432530 (Adcy1)
   04913 Ovarian steroidogenesis
    432530 (Adcy1)
   04915 Estrogen signaling pathway
    432530 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    432530 (Adcy1)
   04921 Oxytocin signaling pathway
    432530 (Adcy1)
   04926 Relaxin signaling pathway
    432530 (Adcy1)
   04918 Thyroid hormone synthesis
    432530 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    432530 (Adcy1)
   04916 Melanogenesis
    432530 (Adcy1)
   04925 Aldosterone synthesis and secretion
    432530 (Adcy1)
   04927 Cortisol synthesis and secretion
    432530 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    432530 (Adcy1)
   04270 Vascular smooth muscle contraction
    432530 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    432530 (Adcy1)
   04971 Gastric acid secretion
    432530 (Adcy1)
   04972 Pancreatic secretion
    432530 (Adcy1)
   04976 Bile secretion
    432530 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    432530 (Adcy1)
   04727 GABAergic synapse
    432530 (Adcy1)
   04725 Cholinergic synapse
    432530 (Adcy1)
   04720 Long-term potentiation
    432530 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    432530 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    432530 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    432530 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    432530 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    432530 (Adcy1)
   04714 Thermogenesis
    432530 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    432530 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    432530 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    432530 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    432530 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    432530 (Adcy1)
   05163 Human cytomegalovirus infection
    432530 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    432530 (Adcy1)
   05142 Chagas disease (American trypanosomiasis)
    432530 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    432530 (Adcy1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     432530 (Adcy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 432530
NCBI-ProteinID: NP_033752
MGI: 99677
Ensembl: ENSMUSG00000020431
Vega: OTTMUSG00000005134
UniProt: O88444
LinkDB All DBs
Position
11 A1; 11 4.72 cM
AA seq 1118 aa AA seqDB search
MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELEALFRGYTLRLEQAAT
LKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLALFVVTNVRSLQVSQLQQ
VGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSTVAEQGVWQLLLVTFVSYALLPVRS
LLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRK
AFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDN
VSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLT
QPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSN
DVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTFLRTHNIETFFIVPSHR
RKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRT
ASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKY
HQLQDEYFTSAVVLALILAALFGLIYLLVIPQSVAVLLLLVFSICFLVACTLYLHITRVQ
CFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCLPWAWSSQSNSSLVVLAAGGRRTVLPA
LPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYILVLELSGYTKVGGGALS
GRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLL
PAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEII
ADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDV
LDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVT
EEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSSHGRTFRLERRMCPYGRGG
GQARRPPLCPAAGPPVRPGLPPAPTSQYLSSTAAGKEA
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccaaggcggcggcggaggcgcgggcgagcccgggggcgca
gagcgggcggccgggccgggcggccggcgtgggttccgggcgtgtggcgaggagttcgcg
tgccccgagctggaggcgctgttccgcggctacacgttgcggctggagcaggcggccacg
ctgaaagcgctggctgtgctcagcctactggcgggcgccctggcgctggctgagctgctg
ggcgcaccggggccagcgccgggcctcgccaaggggtcgcacccagtgcactgcatcctt
ttcctggcgctgttcgtggtcaccaatgtccgatccctgcaggtgtcccagctgcagcag
gtcggtcagctggcgctgttcttcagcctcaccttcgcgctactctgctgccccttcgcg
ctgggcggccccgcgaggagctctgcaggaggcgcaatgggctcgacggtcgccgagcag
ggggtttggcaactccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgcagc
ctactggccatcggcttcgggctggtggtggctgcctcgcacttactggtcacagccgcc
ttggtccctgccaagcgcccacgtctctggaggacgctcggtgccaatgccctgctcttc
tttggtgtgaacatgtatggcgtcttcgtgcggatcttgacagagcgctcccagaggaag
gccttcctgcaggctcgaaactgcattgaggaccggctgcggctggaggatgagaatgag
aagcaggaacggttgctcatgagcctcttgccccggaatgtcgccatggagatgaaggaa
gacttcctgaagccccctgagaggatttttcacaagatttacatccagaggcatgacaat
gtgagcatcctgtttgcagacatcgtgggtttcacaggtctggcgtcccagtgcacagcc
caggagctggtgaaactgctcaatgaactctttggcaagttcgatgagttagccacggaa
aaccactgtcgccgaatcaagatccttggtgactgctactactgtgtgtctggcctcacc
cagcctaagacggatcacgcccactgctgtgtggagatgggacttgacatgatcgatacc
atcacatccgtggctgaggctactgaagtagacctgaacatgcgtgtgggcctacacacc
ggcagggtcctctgtggtgtcctgggcctacgaaagtggcagtatgatgtatggtccaat
gacgtgaccctggccaatgtcatggaggctgctggcttaccagggaaggtccacatcaca
aagacgaccctcgcgtgcttgaacggggactacgaggtggagccaggtcatggccatgag
aggaacacctttctgagaactcacaacattgagaccttctttattgtgccatcccatcgg
aggaagatattcccaggcttgattctctcggatatcaaaccagccaagaggatgaagttc
aagactgtgtgctatctgctggtgcagctcatgcactgccggaaaatgttcaaggctgag
atccccttctccaacgtgatgacctgcgaggatgacgacaagcggagggcattgagaaca
gcctcggagaagctcagaaaccgttcgtctttctctactaatgtggtctacaccactccg
ggtacacgcgtcaacaggtacatcagccgccttctcgaagcccgccagacagagctggag
atggccgatctgaacttctttactctgaagtacaaacatgtcgaacgagaacaaaaatac
caccagcttcaggacgagtacttcaccagcgccgttgtcctcgccctcatcctggctgcc
ttatttgggcttatctaccttctggtaatcccacagagtgtggctgtcctgctgctgctg
gtattttccatctgcttcttggtggcctgtaccctgtacctgcacatcacgcgggtccag
tgttttccagggtgcctgacgatccagatccgcaccgccttgtgtgtgttcatagtggtc
ttaatctactcggtagctcaaggctgtgtggtgggctgcctgccctgggcctggagctct
cagtctaacagttccctagtggtcctcgcagctggtggccggcgcactgtgctgcctgcc
ctgccctgtgagtctgcacaccatgccctgctctgctgcctggtgggcaccctcccacta
gccatattcctgcgggtgtcctccttgccaaagatgatcctgctgtctgggctgactact
tcctacatccttgtcctggagctcagtggatacaccaaggttgggggcggtgccctctct
gggcgcagctatgagccaatcatggctatcctgctgttctcatgcacgctggccctgcac
gccaggcaagtggatgtcagactacggctggactacctctgggcagcacaggcggaggag
gaacgggatgacatggagagagtcaagctggacaacaagaggatcctcttcaatctcctg
ccagctcacgtcgcacagcacttcctcatgtccaatccccggaacatggacctctactac
cagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttctac
atagaactggatggcaacaacatgggtgttgagtgtctgcggctcctcaacgagatcatt
gccgactttgatgagctcatggacaaggacttctataaggacctggagaagattaagacc
attgggagcacttacatggctgccgtggggctggcgcccacagcaggaaccagggctaag
aagtccatctcctcccacctatgcacactggcagacttcgccatcgacatgtttgatgtt
ctggatgaaatcaactaccagtcctacaacgactttgttctccgagttggcatcaacgtt
ggccccgtggttgctggagtgatcggtgctcgcaggccccagtacgacatctggggaaac
acagtcaatgtggccagtcggatggatagcactggggtccagggacgaattcaggtgact
gaggaagtccaccggctgctgaagaggtgctcataccagtttgtgtgcagaggcaaagtc
agcgtgaagggcaagggagagatgctaacgtactttctagaaggcaggactgatggaaac
agttcccacggcaggacctttcgcttggaacgaaggatgtgtccttatgggagaggcgga
ggccaggccagacggcccccactgtgtcccgcggctggacccccagtcagaccagggctc
cctccagcccccactagccagtacctgtcatccacagcagcagggaaggaagcctag

DBGET integrated database retrieval system