KEGG   Mus musculus (mouse): 105844Help
Entry
105844            CDS       T01002                                 

Gene name
Card10, AI449026, Bimp1, Carma3
Definition
(RefSeq) caspase recruitment domain family, member 10
  KO
K20912  caspase recruitment domain-containing protein 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    105844 (Card10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 DinB_2 BLYB Mit_KHE1
Motif
Other DBs
NCBI-GeneID: 105844
NCBI-ProteinID: NP_570929
MGI: 2146012
Ensembl: ENSMUSG00000033170
Vega: OTTMUSG00000035247
UniProt: P58660 E9PUV9
LinkDB All DBs
Position
15; 15 E1
AA seq 1070 aa AA seqDB search
MLGGPGGRRAGGGANDPEGTAPSRLRSRRPSTEPGAQGSCSARGSEDAAMQGRADAGEAD
EEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVLDEQDEEEVLSTYRF
PCRANRTGRLIDILRCRGKRGFEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEGPEG
LTQFLMTEVRRLREARKSQLHREQQLQARGRALEEERAGLEQRLREQQQAQERCQRLRED
WEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALL
RRARGPPPGAEEKEREPDGADLLSELRAENQRLTASLQELQEGLQQEMSRPGAAGSERIL
LDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYLQEMEDLRLKHRTLLKDCDLY
KHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTV
TSLEGTKAMLEAQLQRTQGGSCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAGG
SEPHTSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPEPPKRSFSSMSDITGSVTLK
PWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGWSPPAGLDPQDKSPDS
MPGLGDRWSGAVVRRVLSGPGSARTEQKEPRAEGTGLEGAGLEAEAQQRTLPWNQSSTLP
FLLDSKACHSFHEALDAWAKGPGAEPFYIRANFSLPERSDPHALCVKAQEILRLVDPAHK
RRQEWFCTRVDTLTLRDLDRGTVPNYQRAQQLLEVQEKYLISSRHRSPRSNLKKRALGLV
RPKPAGGTAGDSAEQLPAEPCSELERSLKPYSLVRPLLVSALRPVVLLPECLAPRLIRNL
LDLPSSRLDFQVCPAESLSGEEQCTSSAPGAPKAWPATAGLGSRIRAIQESVGKKHCLLE
LGARGVRELVHSEVYPIVIHVEVTEKNVREIRGLLGRPGWRDSELLRQCRGSEQWLWGLP
CSWVQVPAHAWGHAEELAKVVRGRILQEQARLVWVERGSSRGGSGSSSEA
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtggcccgggaggccgccgggctgggggcggagccaatgaccccgaaggcacc
gccccgtcgcgcctccggagccgtcggccgagcacagagccgggagctcagggcagctgc
agcgcccgtggctcggaggacgcggccatgcagggccgggcggacgcgggcgaggctgac
gaggaggctggggcgggttcggggtcggaggccgaagaggacgcgctgtgggagcggatc
gagggcgtccggcaccgactgacgcgcgccctgaatccggccaagctcacgccgtatctg
cgccagtgccgcgtcctggacgaacaggacgaggaggaggtgctcagcacctaccgtttc
ccgtgccgcgctaaccgtaccgggcgcctcatagacattttacgctgccggggcaagagg
ggcttcgaggccttcctggaagccctggaattctactacccagaacacttcacgctgctc
actggccaggaacctgcccaacgctgctccatgatccttgatgaggagggtcccgagggc
ctgactcagttcttgatgactgaggtccggaggcttcgggaagctcggaagagccaattg
caccgagagcagcaactgcaggcccggggccgggccctggaggaggagcgggcagggcta
gagcagaggcttcgggagcagcagcaggcacaggagcgctgccagcgactgcgggaggac
tgggaggctggcagcctggagctgctgcgcctcaaggatgagaactacatgatcgccatg
cgcctggctcagctcagcgaggagaagaattcggctgtgctgcgcagccgagacctgcag
ctggcggtggaccagctcaagctcaaggtcagccggctggaggaagagtgtgcgctgctg
aggagggccaggggcccaccgcctggggctgaggagaaggagagggagccagatggcgct
gatcttctctctgagcttcgtgcagagaaccagcggctgacggcttcactgcaggagctt
caggaaggtcttcagcaggagatgagccggccaggagctgcaggctctgaacgtatccta
ctggacatactggagcacgactggagggaggcgcaggacagcaggcaggagctgtgtcag
aagcttcatgctgtgcagggcgagctacagtgggcagaggagctgcgggacaagtacctg
caagagatggaggatctgcggctcaaacatcgaacgctgctgaaggactgtgacctctat
aagcaccgcatggccactgtgttggcccagctggaggagattgagaaagagcgggaccag
gcaatccagagccgagaccggatccagctgcagtattctcagagcctcattgagaaggac
cagtaccgcaagcaggtgcgggggctggaggcggagcgcgatgagctgctcaccacagtc
accagcctggaggggaccaaggccatgctggaggcacagctgcagcggacacaggggggt
tcctgtctcaaggcctgtgcctcctcccactccctgtgctccaacctcagcagcacctgg
agcctcagcgagttcccatcgcccctgggaggcccagaagctacaggagaagccggggga
tctgagccccacacctcggaggaagccacagacagcgagaaggagatcaaccggctctct
atcctgcctttcccacccagtgctggttccatactccgccggcagcgtgaggaagacccg
gagccccctaagaggtcttttagcagcatgtcggatatcacagggagtgtgacccttaag
ccatggtcccctggcctctcttcatcatcctcgtctgacagtgtgtggcctttgggaaag
ccggaaggcctcctggctcggggctgtggcctggacttcctcaataggtctctggccatc
cgagtgtccggctggagtccccccgcaggcctggatccccaggataagagtccagatagc
atgccgggccttggagacaggtggtctggggcggtggtgcgaagggtgttgtctgggcct
gggtcagccaggacagaacagaaagagccgagggcggaaggcactggtctggagggggca
ggcctggaagcggaggcccagcagaggaccttgccctggaaccagagctccaccctcccc
ttcctgctggactcaaaggcctgtcattccttccatgaggccctggatgcctgggcaaag
ggaccgggtgccgagcccttctacattcgagccaacttctccctgcccgagcggtcggat
ccccatgccctttgtgtgaaagcccaagagatcctgcggttggtggacccagcccacaag
cggaggcaggagtggttctgtactcgagtggacaccctcaccttacgggacctggaccgg
ggcaccgtgcccaattatcagagagctcagcagctcctagaagtccaggaaaaatacttg
atctccagcagacaccgaagtcctcgaagcaacctgaagaagcgagccctagggttggtg
aggcccaagcctgcagggggcactgcaggagactcagcagaacagctccctgcagagccc
tgctcagagctagaacgaagcctaaaaccctacagcctggtgcgaccgctgttggtgtct
gccttgaggcctgtggtcctcctgcctgagtgcctggcgcctcgcctcatccgtaacctg
ctggatctgccaagctccaggctggatttccaagtgtgcccagcagagagcctctctggg
gaggaacagtgtacgtcctcagctcccggagcccccaaagcctggccggccactgctggg
ctaggcagcaggatccgtgccatccaggagtctgtcgggaagaagcactgcctgttggag
ctgggtgcacggggagtgcgggagttggtgcacagcgaggtctaccccattgtcatccac
gtggaggtgactgagaagaatgtccgtgagatcaggggcctgttgggccggccgggctgg
cgggattcagaactgctccgtcagtgtcggggctcagaacagtggctctggggactgccg
tgttcctgggtgcaggtgcctgcgcatgcgtggggccatgcagaggagctggccaaggtg
gtgcgtggccgaatcttgcaggaacaggctcgccttgtgtgggtggagcgaggcagcagc
agagggggcagtggcagcagtagtgaggcctga

KEGG   Mus musculus (mouse): 108723Help
Entry
108723            CDS       T01002                                 

Gene name
Card11, 0610008L17Rik, 2410011D02Rik, BIMP3, CARMA1
Definition
(RefSeq) caspase recruitment domain family, member 11
  KO
K07367  caspase recruitment domain-containing protein 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108723 (Card11)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    108723 (Card11)
   04662 B cell receptor signaling pathway
    108723 (Card11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD Guanylate_kin PDZ PDZ_6
Motif
Other DBs
NCBI-GeneID: 108723
NCBI-ProteinID: NP_780571
MGI: 1916978
Ensembl: ENSMUSG00000036526
Vega: OTTMUSG00000054841
UniProt: Q8CIS0
LinkDB All DBs
Structure
PDB: 

Position
5; 5 G2
AA seq 1154 aa AA seqDB search
MPGGGPAMDDYMETLKDEEEALWDNVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQVKAKDLQRCELLAKSRQLEDEKKQLSLIRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPRKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDNGSLDQSLPRHLPATIISQNLGDTSPRTNGQEADDSSTS
EESPEDSKYFLPYHPPRRRMNLKGIQLQRAKSPISMKQASEFQVKGHEEDFTDGSPSSSR
SLPVTSSFSKMQPHRSRSSIMSITAEPPGNDSIVRRCKEDAPHRSTVEEDNDSCGFDALD
LDDENHERYSFGPPSIHSSSSSHQSEGLDAYDLEQVNLMLRKFSLERPFRPSVTSGGHVR
GTGPLVQHTTLNGDGLITQLTLLGGNARGSFIHSVKPGSLAERAGLREGHQLLLLEGCIR
GERQSVPLDACTKEEARWTIQRCSGLITLHYKVNHEGYRKLLKEMEDGLITSGDSFYIRL
NLNISSQLDACSMSLKCDDVVHVLDTMYQDRHEWLCARVDPFTDQDLDTGTIPSYSRAQQ
LLLVKLQRLVHRGNREEADSAHHTLRSLRNTLQPEEMLSTSDPRVSPRLSRASFFFGQLL
QFVSRSENKYKRMNSNERVRIISGSPLGSLSRSSLDATKLLTEKHEELDPENELSRNLTL
IPYSLVRAFHCERRRPVLFTPTMLAKTLVQKLLNSGGAMEFTICKSDIVTRDEFLRKQKT
ETIIYSREKNPNTFECIVPANIEAVAAKNKHCLLEAGIGCVRDLIKCKVYPIVLLIRVSE
KNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEAEMWSSVEELLRVLKDKIV
EEQRKTIWVDEDQL
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaggagggccagctatggatgactacatggagacgctgaaggatgaagaggag
gccctatgggataacgtggaatgcaaccggcacatgctgagccgttacatcaaccccgcc
aagctcaccccctacctgcgccagtgcaaggtcatcgatgagcaagatgaagacgaggtg
ctcaatgcgcccatgctgccgtccaagatcaaccgtgcaggccgattgttggacattctt
cacaccaagggacaaaggggctatgtggtcttcctggagagcctggagttttactaccca
gaactttacaaactggtgactggaaaggaacccacccggagattctccaccattgtggtg
gaggaaggccatgagggcctcacacacttcctgatgaacgaggtcatcaaactgcagcag
caagtgaaagccaaggaccttcagcgctgtgagctgctggccaagtcccggcaactggag
gatgagaagaagcagctgagcctgatacgggtggagctgctgaccttccaggagcgatac
tacaagatgaaggaggagcgggacagctacaatgacgagctcgtcaaggtcaaggacgac
aactacaacttagccatgcgctacgcccagctcagtgaggagaaaaacatggcggtgatg
aggagccgcgacctccaactcgagatcgaccagctcaaacaccgactgaacaagatggag
gaggaatgcaagctggagagaaatcagtccctcaagctcaagaatgacatcgagaaccgg
cccaggaaggagcaggtcctggagctggagcgggagaatgagatgctgaagacgaaaatt
caggagctgcagtccatcatccaggctggcaagcgcagcctccctgactcagacaaggcc
atcttggacatcctggaacatgaccggaaggaggcgctagaggaccggcaggaactggtc
aacaaaatttacaacctacaagaggaagtccgccaggcggaggagctgcgggataagtac
ctggaggagaaggaagacctggaactcaagtgttcaaccctggggaaggactgtgaaatg
tacaagcaccgcatgaacacagttatgctgcagctggaggaggtggagcgggagcgggac
caggccttccactcccgagatgaggcacagacacagtactcacagtgcttaatcgagaag
gacaagtaccggaagcagatccgggagctggaggagaagaacgatgagatgcgtattgag
atggtgaggagggaggcctgtattgtcaacctggaaagcaagctccggcgcctgtccaag
gacaacggcagcctcgaccagagtctgcctagacaccttccagccaccatcatctcacag
aaccttggagacaccagccccaggaccaatggccaggaagctgatgattcttcaacctca
gaagagtctcccgaagacagcaagtactttctgccttaccacccaccccggcgccggatg
aacctaaagggcatccagctgcagagagccaaatcccccatcagcatgaagcaagcatct
gagtttcaagtcaaggggcacgaagaggatttcacagacggcagccccagttcctcccgc
tcgctgcctgtcaccagctctttctccaagatgcaaccccatcggagccgcagcagcatc
atgtcaatcacggcagagcccccgggaaatgactccatagtcagacgctgtaaggaagat
gcgccacaccggagcacggtggaagaagacaacgatagctgtgggtttgatgccttagac
cttgacgatgaaaatcacgaacgttattcctttggacctccctccatccactcctcctcc
tcttcacaccagtcagagggactggatgcctacgacctggagcaggtcaacctcatgtta
cgaaagttctctttggaaaggcccttccggccatcggtcacatctgggggtcacgtgcgg
ggcaccgggcccttggtccagcacacaactctgaatggcgatgggctcatcacgcagctc
acccttctgggcggcaatgcacgcgggagcttcattcactctgtcaagccaggctcactg
gctgagagggccggactgcgtgagggccaccaactcctgctgctggaaggttgcatccga
ggcgaaaggcagagcgttccactggatgcgtgcacaaaagaagaggcccgttggaccatc
cagaggtgcagtggcctcatcactctgcattacaaggtcaaccatgaaggataccggaag
ctgctgaaggagatggaggatggtctgatcacatcaggggactcgttctatatccgcctg
aacctgaacatctccagccagctggatgcctgctccatgtccctcaagtgtgacgacgtg
gtgcatgtcctagacaccatgtaccaggacaggcacgagtggctgtgtgcacgagtcgac
cccttcactgaccaagacctggacacgggcaccatccccagctacagccgggctcaacag
cttctcctggtgaagctccagcggttggttcacagaggcaaccgggaagaggcagacagc
gctcaccacaccctgcgcagcctccggaacaccctgcagcccgaagagatgctttcgacg
agcgacccccgagtcagcccccgcctctccagagcgagtttcttctttggccagctcctg
cagtttgtcagccggtcagaaaacaagtacaaaagaatgaacagcaatgagcgcgtgaga
atcatctctgggagtcccctggggagcctctcccggtcctcgctggatgccaccaaactc
ctgaccgagaagcatgaagaactggatcctgagaatgagctcagccggaacctcaccctg
atcccttacagcctggtgcgcgctttccactgtgagcgccgcaggcctgtgctcttcacg
cccaccatgctggccaagacattggtgcagaagctgctcaactcagggggtgccatggag
ttcaccatctgcaagtcagatattgtcacaagagatgagttcctccgaaagcagaagaca
gagaccatcatctactcccgggaaaagaaccccaacacctttgaatgcatcgtccctgcc
aacattgaggctgtggcagccaagaacaaacactgcctgctggaggctgggatcggctgt
gtgcgcgacctgatcaagtgcaaggtgtaccccatagtgctgctcatccgggtgagcgag
aagaacatcaaacggttcaggaagctgctgccgcggccagagacggaagaggaattcctg
cgagtgtgcaggctcaaagagaaggagctggaggcgctgccctgcctctacgccaccgtg
gaagctgagatgtggagcagcgtggaggagctgctgcgagtcctcaaagacaagattgta
gaggagcagcgcaagaccatctgggtggacgaggaccagctgtga

KEGG   Mus musculus (mouse): 170720Help
Entry
170720            CDS       T01002                                 

Gene name
Card14, Bimp2, CARMA2
Definition
(RefSeq) caspase recruitment domain family, member 14
  KO
K20913  caspase recruitment domain-containing protein 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    170720 (Card14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PDZ Guanylate_kin Y_phosphatase VSG_B
Motif
Other DBs
NCBI-GeneID: 170720
NCBI-ProteinID: NP_570956
MGI: 2386258
Ensembl: ENSMUSG00000013483
Vega: OTTMUSG00000003913
UniProt: Q99KF0
LinkDB All DBs
Position
11; 11 E2
AA seq 999 aa AA seqDB search
MAELCRMDSTLTALDEEMLWDMLESHRCRIVQSICPSRLTPYLRQAKVLGQLDEEEILHS
SRFTNSAMRVGHLLDLLKARGKNGAIAFLESLKFHNPDVYTLVTGLQSDIDFSTFSGLME
TSKLTECLAGAISSLQEELAQEKAQKEVLLRRCQQLKERLGLAEAHAEGLRQLEVDHSRM
KREVSTHFHEVLKLKDEMLNLSLHYSNALREKELAATRCHSLQEELYLVKQELQRASLVS
SCERESRERSLKMASNLEPQGEELNRLKEENEKLRSMTFSLVEKDILEQSLDEARESKQE
LVDRIHSLRERAVAAERQQKQYWEEKEQTLLQFRKTQVDCELYKEKMTMLQGQVAELQKE
RDQAYTARDRAQMEISQRLVEKDALRRRVFELTEQVCELRTQLRRLQAEAPGGPKQEAGA
RELCLRGKQRLVRMHAVCPPDDSDCSLLSSTESRLWWDLNSTSSREQMDSFRSSSPMPPS
QQSLYKRVAEDFLEDPESLSFPEVLEMRLQGATVDDTDTDLEFEMIDGADLSQTEDSLQG
SSRSLNVSESSVPVRRRPARKILSQVTVLAFQGDALLEQIGVIGGNLTGIFIHRVTPGSA
ADEMALRPGTQIMMVDYKPTKPSLRATLENTTLEQAVGLLRRVNGSCYLSVKINTEGYKN
LIQDLDAKVVTSGDSFYIRVNLAMQRGGDGELQTHCNDILHVTDTMFQGRSCWHAHHVNP
YTMKDMEPGTIPNYSQAQQQLLALIQDMTQRCTVPRKPPGGPQKLVRIVSVDKAAVSPLT
SSFDQSQWDSGKEEGGPSVCFWSESCFTLAPYTLVHPHRPARPRPVLFVPRLVGRILGKK
LCLLQGFKQCSAEYLSQEEYATWSQRGDIIQEGESIGDHHWITRHAVESLMNMSTHALLD
VRLDSVRVLHRMDMFPIIIHVSVNEKTAKKLRKGLHRLGSSEEQFLEVARQEEGELDRVP
CLYSSLAPDSWSDLDSLLSCVRLAIADEQKKVVWTESPC
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactgtgccgcatggattccacactgactgctctggacgaggagatgctctgg
gatatgctggagagtcaccgatgcaggattgtgcagagcatctgccctagccggctcacc
ccctacctgcgccaggccaaggtgctgggccagctggacgaggaggagatcctgcatagc
tcccgtttcaccaacagtgccatgagagttgggcacttgctggatctgctaaaggcccga
gggaagaatggagccattgcctttctggaaagcctgaagttccacaaccctgatgtctac
accctggtcactgggctgcagtctgacattgacttcagcactttcagcggtctcatggag
acatccaagctgaccgagtgtctggctggggccatcagcagcctgcaggaggagctggcc
caggagaaggcacagaaggaggttctgctccggagatgccagcagctgaaggagcgcctg
ggcttggctgaggctcacgcagaaggtctgcgccagctggaggtcgaccacagccgcatg
aaacgtgaggtcagcacccacttccacgaggtcctgaaactgaaggacgagatgctgaac
ctgtcactgcactacagcaacgcactcagagagaaggagctggctgccacacgctgccac
agccttcaggaagagctctacctggtgaagcaggaactccagcgagcaagccttgtatcg
tcatgtgaaagagaatctcgagagaggtccctgaagatggccagcaacctggagcctcag
ggagaagaactaaatcggcttaaggaggagaatgagaaactccgctccatgaccttcagc
ctggtggagaaggacattctggaacagagtctggatgaggccagggagagcaagcaagag
ctggtggaccgcatccactcactgcgggagagagcagtggccgcggagaggcagcagaag
cagtactgggaggagaaggaacagaccctactccagttccggaagacacaggtggactgt
gaactatacaaagaaaagatgaccatgcttcagggccaggtggctgagctgcagaaggaa
cgtgaccaggcatacacagcaagggacagggcccagatggagatttctcagcgcctggtg
gagaaggatgcccttcgcaggagagtgttcgagctgacggagcaggtctgtgagctgcgt
actcagctgcgcaggctgcaggcggaggccccaggaggacccaagcaggaagccggagcc
agggaactctgcctccgggggaagcagaggcttgtgcggatgcatgctgtgtgcccacca
gatgacagtgactgcagcctcctcagctccacagagtcccggctgtggtgggacctgaat
tccacatccagccgggagcagatggacagcttccgctccagcagccccatgcctcccagc
cagcagtccctgtacaagcgggtggcagaggacttcctggaagaccccgagtctctaagc
ttcccagaagtccttgagatgcgccttcaaggggctacagtggacgacacagacacagac
ctggagtttgagatgattgacggagcagacctctctcagacagaagacagcctgcagggg
tcttcccggagcctgaatgtctcagaaagcagtgtccccgtgaggaggaggccagcccgc
aagatcctaagccaggtcacggtgctggcgttccaaggggacgcgttgctggaacagatt
ggtgtcatcggtgggaacctcactgggatcttcattcaccgtgtcacccccggctctgca
gcagatgagatggccctgcgccctggtacccagatcatgatggtggactataaacctacc
aagccatcattaagggccactctggagaatacaacgctggagcaggctgtgggccttctc
aggagggtgaatggctcctgctacttgtctgtgaagatcaacactgaaggttataagaac
ctcatccaggacctagatgccaaagtggtaacgtctggggattccttctacatccgtgtc
aacctggccatgcagaggggaggggacggagaactgcaaactcactgcaatgacatcctg
catgtcactgacaccatgttccaaggccgcagctgctggcatgcccaccatgtgaacccc
tacaccatgaaagacatggagcctggcaccatccccaactattcacaggctcagcagcag
cttctggccctcatccaggacatgactcaacggtgcacagtcccccgcaagcctcctgga
ggaccacagaagttagtacgaattgtcagtgtggacaaagccgctgtcagtcctctgact
tcatcctttgaccaaagccagtgggattctggcaaggaggaaggtggtcctagcgtgtgc
ttctggtcagagagctgcttcaccctggcaccgtacaccctggtgcacccccacaggcct
gcccggccccggcctgtgctgtttgtgcctagattagttggaaggatcctgggtaaaaag
ctgtgtctcctccaaggttttaagcaatgttcagcagagtacttgagccaggaggagtat
gccacctggagtcagagaggggacatcatccaggagggagagtcaataggtgaccaccac
tggatcacccggcatgctgtggagtccctcatgaatatgagcacccacgccctgctggat
gtgcggctggacagcgtccgagtcctacataggatggacatgtttcccattatcatccat
gtctctgtcaatgagaagacagcaaagaaactcaggaagggcctgcatcggcttggcagc
tcggaggagcagttcctggaggtggcccggcaggaggagggagagctggacagagtgccg
tgtctgtacagcagcctggcccccgacagctggagtgatctggacagcctgctcagctgt
gtgcgcctggccattgcagatgagcagaagaaggtggtgtggacagagagcccctgctga

DBGET integrated database retrieval system