KEGG   Mus musculus (mouse): 106759Help
Entry
106759            CDS       T01002                                 

Gene name
Ticam1, AW046014, AW547018, TICAM-1, TRIF
Definition
(RefSeq) toll-like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    106759 (Ticam1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106759 (Ticam1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106759 (Ticam1)
   04621 NOD-like receptor signaling pathway
    106759 (Ticam1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106759 (Ticam1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106759 (Ticam1)
   05133 Pertussis
    106759 (Ticam1)
  09172 Infectious disease: viral
   05164 Influenza A
    106759 (Ticam1)
   05161 Hepatitis B
    106759 (Ticam1)
   05160 Hepatitis C
    106759 (Ticam1)
   05168 Herpes simplex virus 1 infection
    106759 (Ticam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106759 (Ticam1)
   05165 Human papillomavirus infection
    106759 (Ticam1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    106759 (Ticam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRIF-NTD RHIM TIR_2
Motif
Other DBs
NCBI-GeneID: 106759
NCBI-ProteinID: NP_778154
MGI: 2147032
Ensembl: ENSMUSG00000047123
Vega: OTTMUSG00000016637
UniProt: Q80UF7
LinkDB All DBs
Position
17; 17 D
AA seq 732 aa AA seqDB search
MDNPGPSLRGAFGILGALERDRLTHLKHKLGSLCSGSQESKLLHAMVLLALGQDTEARVS
LESLKMNTVAQLVAHQWADMETTEGPEEPPDLSWTVARLYHLLAEENLCPASTRDMAYQV
ALRDFASQGDHQLGQLQNEAWDRCSSDIKGDPSGFQPLHSHQGSLQPPSASPAVTRSQPR
PIDTPDWSWGHTLHSTNSTASLASHLEISQSPTLAFLSSHHGTHGPSKLCNTPLDTQEPQ
LVPEGCQEPEEISWPPSVETSVSLGLPHEISVPEVSPEEASPILPDALAAPDTSVHCPIE
CTELSTNSRSPLTSTTESVGKQWPITSQRSPQVPVGDDSLQNTTSSSPPAQPPSLQASPK
LPPSPLSSASSPSSYPAPPTSTSPVLDHSETSDQKFYNFVVIHARADEQVALRIREKLET
LGVPDGATFCEEFQVPGRGELHCLQDAIDHSGFTILLLTASFDCSLSLHQINHALMNSLT
QSGRQDCVIPLLPLECSQAQLSPDTTRLLHSIVWLDEHSPIFARKVANTFKTQKLQAQRV
RWKKAQEARTLKEQSIQLEAERQNVAAISAAYTAYVHSYRAWQAEMNKLGVAFGKNLSLG
TPTPSWPGCPQPIPSHPQGGTPVFPYSPQPPSFPQPPCFPQPPSFPQPPSFPLPPVSSPQ
SQSFPSASSPAPQTPGPQPLIIHHAQMVQLGVNNHMWGHTGAQSSDDKTECSENPCMGPL
TDQGEPLLETPE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggataacccagggccttcgctccgtggtgcctttggcattctaggtgccttggaaagg
gacaggctgacccacctgaaacacaagctggggagtctgtgttcaggcagccaggagtca
aagcttctccatgccatggtactcctggctctgggccaggacacggaggccagggtctct
ctggagtccttgaagatgaacacagtagcccagctggtagcccaccagtgggcagacatg
gagaccacagagggccctgaggagcctccagacttgtcctggacggtggctcgcctgtac
cacctgctggctgaggagaacctgtgtccggcctccacaagggacatggcttaccaggtg
gcccttcgtgactttgcctcccagggtgaccaccagctgggccaactccagaatgaggcc
tgggatcggtgcagttcagatatcaagggggaccccagtggtttccagccactccattct
catcagggttccctgcagccaccttcagcatcccctgcagtgaccagaagccagcctcgt
cccattgacacaccagactggagttggggacatacgttacactccaccaacagcactgcc
tcactggccagccacctagagatcagccagtcacccactcttgcctttctctcttcacac
catggaacccatgggcccagcaagctatgtaacacaccgctggacactcaggagcctcag
cttgtccctgaaggctgccaagaacctgaggagataagctggcctccatcagtggagacc
agtgtctccttagggttaccacacgaaattagcgttccagaggtgtctccagaggaggct
tcgcccatcctccctgacgccctggctgctccagacacaagtgtccactgtcccattgaa
tgcacagagttgtctacaaactccaggtctcccctgacgtccaccacagaaagtgttgga
aagcagtggcctattacaagtcagaggtcacctcaggttcctgtaggagatgattctctg
cagaacaccacgtcatccagccctcctgcccagccaccatccctccaagcctcccctaag
ctgcctccttcccctctgtcctctgcttcctccccgagcagctaccctgctcctccaacc
tccacatcccctgttttggaccactcagaaacatctgatcagaaattctataactttgtg
gttatccatgccagggctgatgaacaggtggccctacgtattcgggagaagctggagacc
ctcggggtacctgacggggccaccttctgtgaggaatttcaggtgcccgggcgtggtgag
ctgcactgtctccaagatgccatcgatcactcggggttcacgatcctgctcctgactgct
agctttgattgcagcctgagcctgcatcaaatcaaccatgctctcatgaacagccttaca
cagtctgggaggcaggactgtgtgatccccctcctcccacttgagtgttctcaggcccag
ctcagcccagatacaaccagactgctccacagcattgtgtggctggatgaacactcccca
atcttcgccagaaaggtggcaaacaccttcaagacacagaagctccaggcacagcgggta
cgctggaagaaagcgcaggaggccagaaccctcaaggagcagagcatacagctggaggca
gagcggcaaaacgtggcagccatatctgctgcctacacagcctatgtccatagctatagg
gcctggcaagcagagatgaacaaacttggggtggcttttgggaagaacttgtcactgggg
actccaacacccagctggcccggatgtccacagccaataccttctcatcctcagggtggt
actccagttttcccctattccccacagcctccatccttccctcagcctccatgcttccct
cagcctccatccttccctcagcctccatccttcccactgcctccagtctcttccccacag
tcccaatcctttccatcagcctcctccccagccccacagactccaggacctcagcctctc
attattcaccatgcccagatggttcagctgggtgtcaacaatcacatgtggggccacaca
ggggcccagtcatctgatgacaagactgagtgttcggagaacccctgtatgggccctctg
actgatcagggcgaaccccttcttgagactccagagtga

DBGET integrated database retrieval system