KEGG   Mus musculus (mouse): 107589Help
Entry
107589            CDS       T01002                                 

Gene name
Mylk, 9530072E15Rik, A930019C19Rik, AW489456, KRP, MLCK108, MLCK210, Mlck, nmMlck, smMLCK
Definition
(RefSeq) myosin, light polypeptide kinase
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107589 (Mylk)
   04020 Calcium signaling pathway
    107589 (Mylk)
   04022 cGMP-PKG signaling pathway
    107589 (Mylk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107589 (Mylk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107589 (Mylk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107589 (Mylk)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107589 (Mylk)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107589 (Mylk)
  09154 Digestive system
   04971 Gastric acid secretion
    107589 (Mylk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    107589 (Mylk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107589 (Mylk)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107589 (Mylk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set Pkinase_Tyr C2-set_2 fn3 Ig_6 Ig_C17orf99 Ig_4 Kinase-like Kdo AvrM_N
Motif
Other DBs
NCBI-GeneID: 107589
NCBI-ProteinID: NP_647461
MGI: 894806
Ensembl: ENSMUSG00000022836
Vega: OTTMUSG00000017049
UniProt: B1B1A8
LinkDB All DBs
Position
16; 16 B3
AA seq 1950 aa AA seqDB search
MSGQLPGKTMGDVKLFASSHMSKTSHSVDPSKVSSMPLTEAPAFILPPRNLCVKEGATAK
FEGRVRGYPEPQVTWHRKGQAITNGGRFLLDCGVRGTFSLVIHTVREEDKGKYTCEASNG
SGARQVTVELTVEGNSMKKRDQPVLSKASGFPGETRPSIWGECPPKFATKLGRAVVKEGQ
MGRFSCKITGRPPPQVTWLKGNVPLQPSARVSMSEKNGMQILEIRGVTRDDLGVYTCMVV
NGSGKASMSAELSIPGLDNAARLAVRGTKAPSPDIRKEVTNGVSKDPETVAESKNCPSPQ
RSGSSARATNSHLKSPQEPKPKLCEDAPRKVPQSSILQKSTSTITLQALKVQPEARVPAI
GSFSPGEDRKSLAAPQQATLPTRQSSLGGSVGNKFVTGNIPRESQRESTFPRFESQPQSQ
EVTEGQTVKFICEVSGIPKPDVGWFLEGIPVRRREGITEVYEDGVSHHLCLLRARTRDSG
RYSCTASNSLGQVSCSWSLLVDRPNLAQTAPSFSSVLKDSVVIEGQDFVLRCSVQGTPAP
RVTWLLNGQPIQFAHSICEAGVAELHIQDALPEDRGTYTCLAENAMGQVSCSATVTVQEK
KGEGEREHRLSPARSKPIAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHDGNEI
QESEDFHFEQKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTRAVLTVQEPHDGTQPWF
ISKPRSVTATLGQSVLISCAIAGDPFPTVHWLRDGRALSKDSGHFELLQNEDVFTLVLKN
VQPWHAGQYEILLKNRVGECSCQVSLMLHNSPSRAPPRGREPASCEGLCGGGGVGAHGDG
DRHGTLRPCWPARGQGWPEEEDGEDVRGLLKRRVETRLHTEEAIRQQEVGQLDFRDLLGK
KVSTKTVSEDDLKDIPAEQMDFRANLQRQVKPKTISEEERKVHSPQQVDFRSVLAKKGTP
KTPVPEKAPPKAATPDFRSVLGGKKKSPSENGGNSAEVLNVKAGESPTPAGDAQAIGALK
PVGNAKPAETPKPIGNAKPTETLKPVGNTKPAETLKPIANAQPSGSLKPVTNAQPAEPQK
PVGNAKSAETSKPAGKEEVKEVKNDVNCKKGQVGATGNEKRPESQGSAPVFKEKLQDVHV
AEGEKLLLQCQVISDPPATVTWSLNGKTLKTTKFIVLAQEGSRFSVSIEKALPEDRGLYK
CVAKNSAGQAECSCQVTVDDAQTSENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPK
TPTKAAMPPQIIQFPEDQKVRAGEPVELFGKVAGTQPITCKWMKFRKQIQESEHIKVENG
ESGSKLTILAARQEHCGCYTLVVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLT
LSWYGSSYDGGSAVQSYNVEIWDTEDKVWKELATCRSTSFNVQDLLPDREYKFRVRAVNV
YGTSEPSQESELTAVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQKVSDVYDIEER
LGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKDNIRQEISIMNCLHHPKLVQCVDAFE
EKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPE
NIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGV
ICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLD
CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSG
RKSSTGSPTSPINAEKLESEDDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFD
CKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLG
EATCTAELIVETMEEGEGEEGGEEEEEEEE
NT seq 5853 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccagttacctgggaagaccatgggggacgtgaaactgtttgcctcgtcacac
atgtctaaaacctcccacagtgtggatccctcgaaggtcagctccatgcctctcaccgag
gccccagctttcattctgccccctcggaacctctgcgtcaaagaaggagccacagccaag
ttcgaagggagggtccggggctacccagagccccaggtgacatggcacagaaaagggcaa
gccatcaccaatggtggccgcttcctgctggactgtggagtgcgggggacttttagtctt
gtcatccacactgtccgcgaggaggacaagggcaaatacacctgtgaagctagcaatggc
agtggcgcccgccaggtgaccgtggagctgactgtggaagggaattctatgaagaagcgt
gatcagcctgttctttctaaagcctcaggatttccaggggagactcgtcctagcatctgg
ggtgagtgcccaccaaagtttgccaccaagctgggcagagctgtggtcaaagaagggcag
atggggcgattctcctgcaagatcactggccggcctccaccacaggtcacctggctcaag
ggaaatgtcccgttgcagccaagtgcccgtgtgtcaatgtcagagaagaatggcatgcag
atcctggagatccgtggggtcactcgggatgacctgggcgtgtacacctgcatggtggtg
aatgggtcagggaaagcctccatgtcggcggagctctccatcccaggtttggacaatgcc
gctaggttggctgtgagaggaaccaaagcccccagtccagacatcaggaaggaggtgacc
aatggagtctccaaagacccagagactgtggctgaaagtaagaactgtccaagtccccag
aggagtggctcctcagcccgggccaccaacagtcacctcaagtccccgcaggagcccaag
ccaaagctgtgtgaggatgctcccagaaaggtcccgcagtcctccatcctgcagaagtcc
accagcaccatcactctgcaggccttgaaagtccagccagaagcgagagtaccagccata
gggtccttctctcctggggaagacaggaagagtctggctgcccctcagcaagccacactc
cctaccagacagtctagcctgggaggttccgttgggaacaagtttgttaccgggaacatc
cccagagagagccaaagggagtcaacattccccagatttgagagtcagccccaaagccag
gaagtcactgaaggtcagacagtcaagttcatctgcgaggtttcaggtataccaaagcct
gacgtgggctggttcctggaaggcatccccgtgaggagacgggaaggcatcactgaggtt
tatgaagatggtgtatcccatcacctgtgcctgctgagagcccggacgagagacagtggg
aggtacagctgcacagcatccaatagccttggccaggtgtcctgcagctggagcctgctg
gtggaccggccgaacttggcacagacagccccttcattctctagtgttctgaaggacagt
gttgtcattgagggccaggattttgtgctacggtgctcagtgcaggggactccagcaccc
cgggtcacgtggctgctcaatggacagcccatccagtttgctcactccatctgtgaggca
ggcgtggctgagctccacatccaggatgccctgccagaggaccgtggcacctacacctgc
ctggctgagaatgccatggggcaggtgtcctgcagcgccactgtcaccgtccaagagaag
aaaggtgaaggagagagggaacaccgtctgtccccagctcgcagcaagcccatcgcaccc
atcttcctgcagggcctctccgacctcaaagtcatggatggaagccaggtcactatgaca
gtccaggtgtcagggaacccacctccggaagtcatctggcttcacgacgggaatgagatt
caggagtccgaggacttccacttcgagcagaagggtggctggcacagcctgtgtatccag
gaggtgttcccggaggacacgggcacgtacacctgtgaggcctggaacagtgccggggag
gtccgcacccgggccgtcctcaccgtgcaagagcctcatgatggcacccagccctggttc
atcagcaagcctcgttcggtgacagccaccctgggccagagtgtcctcatctcctgcgcc
atagctggagacccctttcccaccgtgcactggctccgggatggcagagccctctccaag
gacagtggccactttgagctgctccagaatgaggacgtgttcaccctggttctaaagaac
gtgcagccctggcatgccggccagtatgagattctgctcaagaaccgggttggcgagtgt
agttgccaagtgtcactgatgcttcacaacagcccttccagagccccaccacgggggcgg
gagcctgccagctgcgagggcctctgtggtggtggaggagttggtgctcatggtgatggt
gaccgtcatgggaccctgaggccctgctggccagcaagagggcaaggttggcctgaggag
gaagacggagaagacgtgagggggctgttgaagagacgggtggagaccaggctgcacaca
gaagaggccatccgccagcaggaggtggggcagctggattttcgagacctcctgggaaag
aaggtgagcaccaagaccgtctcagaagacgacctgaaggacatcccagccgagcagatg
gatttccgcgccaaccttcagcggcaagtgaagccaaagaccatatccgaggaagagagg
aaggtgcatagccctcagcaggttgacttccggtctgtcctcgccaagaaggggacccct
aagacccccgttcctgagaaggcacctccaaaagctgccaccccagactttcgctctgtg
ctaggtggcaagaagaagtcaccctcggagaatgggggcaacagcgctgaggtcttgaat
gtcaaggctggggaaagccccacacctgcaggcgatgcgcaggccatcggggccctgaaa
cccgtaggcaatgccaagcctgctgagaccccgaaacctataggtaatgccaagcctacc
gagaccctgaagcctgtgggcaacaccaagcctgccgagaccctgaaacccatagccaac
gcacagccttcagggtccctgaaacctgtaaccaacgcacaacctgctgagccccagaag
cctgtgggcaatgccaagtctgctgagacctcgaaaccagctgggaaagaagaagtcaag
gaggtaaagaatgatgtgaactgtaagaaagggcaggtcggagccacgggcaatgaaaag
cgacccgagagccaaggctcggccccagttttcaaggaaaagctacaagatgtccatgtg
gcagagggggagaagctgctactccaatgccaggtgatctctgatccccccgccactgtc
acctggtcgctgaatgggaagacactcaagaccacaaaattcatcgtcctcgcccaagaa
ggctcacgtttctctgtctccatcgagaaggcactgcctgaggaccgaggtttgtacaag
tgtgtagccaagaacagcgctggccaggcagagtgttcctgccaagtcactgtggacgat
gctcagaccagtgagaacaccaaggccccggagatgaaatcccggagacccaagagctct
cttccccctgtgctaggaacagagagcgacgcaactgtgaaaaagaaacctgcccccaag
acacccacaaaagcagctatgccccctcaaatcatccagttccccgaggaccagaaggtg
cgcgcaggagaacctgtggagctgtttgggaaagtggctggcacccagcccatcacctgc
aagtggatgaagttccgaaagcagatccaggagagcgagcatatcaaggtggagaatggc
gagagcggcagcaagctcaccatcctggccgcgcggcaggagcactgtggctgctacaca
ctggtggtggagaacaagctgggcagcaggcaggcccaagtcaacctcacggtcgtggat
aagccagaccccccggctggcacaccttgtgcttctgacattcggagttcctcactgacc
ctgtcctggtatggctcctcatatgatgggggcagtgctgtacagtcctacaatgtggag
atctgggacacagaggacaaggtgtggaaagagctagccacgtgccgcagcacctctttt
aatgtccaagacctgctgcctgaccgcgagtacaaattccgagtgcgtgcagtcaacgtc
tatggaaccagcgagccaagccaagagtccgagctcacagctgtgggagagaaacctgaa
gagccaaaggatgaagtggaagtgtccgatgatgacgaaaaggaacctgaggttgattac
cggacggtgactgttaacactgaacagaaagtgtctgatgtgtatgacattgaagagcga
ctaggatctgggaagtttggacaagtcttccgacttgtggaaaagaaaactggaaaaatc
tgggcagggaaatttttcaaggcctattccgccaaggagaaagacaacatccgtcaggag
atcagcatcatgaactgcctccaccaccccaagctggtccagtgtgtggatgccttcgaa
gaaaaggccaacattgtcatggttctggagatcgtgtccgggggtgagctgtttgagcgt
atcattgacgaggacttcgagctgacggagcgggagtgtatcaagtacatgaggcagatc
tcggaaggggtggagtacatccacaagcagggcattgtgcacctggacctcaagcccgag
aacatcatgtgtgtcaacaagacaggcaccaggatcaagctcattgacttcggcctggca
cggagactcgagaacgctgggtctctgaaggtcctctttgggaccccagagtttgtggct
cctgaagtgatcaactatgagcccatcggctacgccacagacatgtggagcatcggggtc
atctgctatattctggtcagcggactttctcccttcatgggtgacaatgataacgagacc
ttagccaacgtcacttcagccacctgggacttcgatgacgaggcattcgatgagatctcc
gatgacgcaaaggatttcatcagtaacttgctgaagaaagatatgaaaaaccgtctggac
tgcacccagtgccttcagcacccatggctgatgaaagacaccaagaacatggaggccaag
aagctgtccaaggaccggatgaagaaatacatggcaagaaggaagtggcagaaaacgggc
aatgctgtgagagccatcgggagactgtcctctatggcaatgatctcagggctcagtggc
aggaaatcttcaacagggtcaccaaccagcccaatcaatgcggagaaactagagtctgaa
gacgatgtctcccaagctttcctggaggctgttgctgaggaaaagccccatgtgaaacct
tatttctctaagaccatccgtgatctggaagtcgtggagggaagcgctgctagatttgac
tgcaagattgaaggatacccagaccctgaggtggtctggttcaaggatgaccaatcaatc
agggagtcccgccacttccagatagactacgacgaagacggcaactgctcgctcatcatc
agcgacgtctgtggggatgatgacgccaagtacacctgcaaggctgtcaacagcctcgga
gaagccacctgcactgcggagctcatcgtggagaccatggaggaaggggaaggggaggag
gggggagaggaggaggaggaggaggaggagtga

KEGG   Mus musculus (mouse): 213435Help
Entry
213435            CDS       T01002                                 

Gene name
Mylk3, D830007F02Rik, MLCK
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    213435 (Mylk3)
   04020 Calcium signaling pathway
    213435 (Mylk3)
   04022 cGMP-PKG signaling pathway
    213435 (Mylk3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    213435 (Mylk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    213435 (Mylk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    213435 (Mylk3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    213435 (Mylk3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    213435 (Mylk3)
  09154 Digestive system
   04971 Gastric acid secretion
    213435 (Mylk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    213435 (Mylk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     213435 (Mylk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   213435 (Mylk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 213435
NCBI-ProteinID: NP_780650
MGI: 2443063
Ensembl: ENSMUSG00000031698
Vega: OTTMUSG00000031870
UniProt: Q3UIZ8
LinkDB All DBs
Position
8; 8 C3
AA seq 795 aa AA seqDB search
MSGVSEEDPEGLAPQGLPALGGACLATMDKKLNVLTEKVDRLLHFQEDVTEKLQCVCQGM
DHLEQDLHRLEASRELSLAGSGSTPPTTAQAAWPEVLELVRAVRQEGAQHGARLEALFKM
VVAVDRAITLVGSTFQNSKVADFIMQGTVPGRKGSLADGPEENKEQAEVAGVKPNHVLTT
GGVQADASRTLWEESQKEDIPVRTVEGLPLIINTSLKGADLTQAGASLRQGVEVLGPGQV
PLPTEAESRLPETASENTGATLELSVAIDRISEVLTSLKMSQGGGQETSSSKPDCWLSEE
AMRLSSGPLPQPLGPLTPDSDIHSGDALPRIPINMQEMATPGELLETQSGSPIGSAEAPG
LGTVLEDQIPKGARPFPPLPKRSSNNGGMSAEEEIGSGAEPMRGPSLATRDWRDETVGTT
DLQQGIDPGAVSPEPGKDHAAQGPGRTEAGRLSSAAEAAIVVLDDSAAPPAPFEHRVVSI
KDTLISAGYTVSQHEVLGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIM
NQLSHVNLIQLYDAFESKSSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGV
HYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVV
NYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAK
DFVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNVRLRSQQLLQKYMAQSKWKKHFH
VVTAVNRLRKFPTCP
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagtttcagaggaggacccagagggtctggccccccagggtctgccagcattg
ggcggagcctgcttagccaccatggacaaaaaacttaatgtgctgactgagaaggtcgac
agactcttgcatttccaagaagatgtcacagagaagctgcagtgtgtgtgccaaggcatg
gatcacctggaacaagatctgcatcggctggaggcctcccgggagttgagtctggcaggg
tctggcagcactcccccaaccacggctcaggccgcatggcctgaggtcctggagctggtg
agggctgtgcggcaggagggtgcccagcatggtgccaggctcgaagccctcttcaagatg
gtggtggctgtggacagggctattactttggtagggtccacattccagaattccaaggtg
gctgatttcatcatgcaaggaaccgtgcccgggagaaaaggcagtctggccgatggcccg
gaggagaacaaggagcaagcagaagttgctggagtgaagccaaaccatgtactgactaca
ggaggtgtgcaagctgacgcctctaggacgctgtgggaagagagccaaaaggaggacata
cctgtgcgaacagtggaggggctgcctctcatcatcaatacgtcactgaagggagctgac
ctaacccaggcaggagcctcactgaggcagggagttgaagttcttggcccaggccaagta
cccctacccacagaagcagaatccaggcttcctgagacagccagtgagaacactggagcc
accctggaattgtccgtagcaatcgacagaatcagcgaggtcctcactagcctcaagatg
tcacaaggtggtggtcaagaaacctcatccagcaagcctgactgttggctttcagaagag
gccatgaggctgagttcagggcctctccctcagcccctaggaccactaactccagacagt
gacattcacagtggtgatgcacttcccaggatccctatcaatatgcaagagatggctact
cctggggagttgcttgagacccaaagtggcagtcccattggctctgcagaagctccaggc
cttgggactgtgttagaagaccagatccctaaaggagccagaccatttccacccctgcca
aagaggagcagcaacaatggtggcatgagtgcagaggaggagatagggtctggggctgag
cctatgagaggaccaagcttggctacaagggactggagagatgagactgttgggaccaca
gacctgcagcaaggcatagacccaggagcagtgagccctgagcctgggaaggaccacgca
gcccagggcccaggaagaactgaagctggaaggctatcttctgctgcagaggctgccatt
gtggttctagatgacagcgcagcacccccagccccttttgaacaccgggtagtgagcatc
aaagataccctgatctcagcaggctacacggtatcccaacatgaagtcttaggagggggt
cggtttggccaggtgcacaggtgtacagagaggtctacaggccttgcactggcagccaag
atcatcaaagtgaagaacgtaaaggaccgggaggatgtgaagaatgaggtcaacatcatg
aaccagctcagccacgtaaacttgatccaactttatgatgcgtttgagagcaagagcagc
ttcactctgatcatggagtatgtggatggaggcgaactctttgaccggatcacggatgag
aagtaccacctcactgagttggatgtggtcttgttcacgaggcagatctgtgagggtgtg
cattacctgcatcagcactatatcctgcacctggacctcaagcctgagaacatattgtgt
gtcagccagacagggcatcaaattaagatcattgactttgggctggctagaagatacaag
cctcgggagaagctaaaggtgaactttggtactccggagttcctggccccagaagttgtt
aactatgagtttgtgtcatttccaacagacatgtggagtgtgggagttatcacctacatg
ctactcagtggtttgtccccatttctaggggagacagatgcagagaccatgaattttatt
gtgaactgcagctgggatttcgatgctgataccttcaaagggctgtcggaggaagccaag
gactttgtttcccggttactggtcaaagagaagagctgtaggatgagcgccacacagtgc
ctgaaacacgagtggttaagtcacctgcctgccaaagcctcgggctccaacgttcgcctc
agatcccaacaactgctgcagaaatatatggctcagagtaaatggaagaaacatttccac
gtggtgactgcagtcaacaggctacggaaatttccaacgtgtccctaa

KEGG   Mus musculus (mouse): 228785Help
Entry
228785            CDS       T01002                                 

Gene name
Mylk2, 9830004H17Rik, BB138278
Definition
(RefSeq) myosin, light polypeptide kinase 2, skeletal muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    228785 (Mylk2)
   04020 Calcium signaling pathway
    228785 (Mylk2)
   04022 cGMP-PKG signaling pathway
    228785 (Mylk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    228785 (Mylk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    228785 (Mylk2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    228785 (Mylk2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    228785 (Mylk2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    228785 (Mylk2)
  09154 Digestive system
   04971 Gastric acid secretion
    228785 (Mylk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    228785 (Mylk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     228785 (Mylk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   228785 (Mylk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 228785
NCBI-ProteinID: NP_001074513
MGI: 2139434
Ensembl: ENSMUSG00000027470
Vega: OTTMUSG00000015847
UniProt: Q8VCR8
LinkDB All DBs
Position
2; 2 H1
AA seq 613 aa AA seqDB search
MTTENGAVELGSQSLSTEQTPKAAAGDGPSASEKEPSAPATEKDLSPPNAKKDPGAPDPK
NNPDPPSLKKDPAKAPGPEKKGDPVPASASSQGPSGEGDGGGGPAEGSEGPPAALPLPTA
TAEASIQKLDPTQAPSGNQGSGEAKAGKKAAECREAGRRGSPAFLHSPSCPAIISCSEKT
LAVKPLSETTDLVFTGVSVTPDPQDPGPVKAGGTNALAEKKKEEAEKASGQAGQAKVQGD
TPQRIGFQAVPSERVEVGQALCLTAREEDCFQILDDCPPPPAPFPHRIVELRTGNVNSEF
SMNSKEALGGGKFGAVCTCTERATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLI
QLYAAIETSHEIILFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVL
HLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKT
DMWSLGVITYMLLSGLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDEAKDFVSNLLTK
DQSARMSAEQCLAHPWLNNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFK
KISSSGALMALGV
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgactacagaaaacggagcagttgagctgggaagccagagcctgtcaacagaacagaca
cctaaagccgctgcaggtgatggaccttcagcttcagaaaaagaacccagcgccccagcc
acagagaaagacctgagcccccctaacgcgaagaaagacccgggcgcgccagatccaaag
aacaatccagatccaccctccctgaagaaagatcccgccaaagcccctggcccagagaaa
aagggtgacccggtcccagcttcagccagcagccagggcccttcaggagagggagatgga
ggtgggggacctgctgaaggcagtgaggggcctcctgcagccttgcccctgcccactgct
acagccgaggccagcatccagaagctggaccccacgcaagcaccctcaggcaaccaggga
tccggagaagccaaggcaggcaagaaggcagcagaatgccgcgaagcaggaagaaggggc
tcacctgcctttctccacagccctagctgcccggctatcatctcctgctctgagaagaca
ctggctgtgaagcccctaagcgagacaacagacctcgtctttacaggggtgtctgtgacc
cctgacccccaagatcctggtccagtcaaagcaggagggacaaacgccctggcagagaag
aagaaggaagaggcagagaaagcctcaggccaggccgggcaggctaaggtgcaaggggac
accccccagaggatcgggttccaggctgttccctcagagagagtggaggtggggcaggcc
ctctgtctcactgccagggaggaagactgcttccaaatcctggatgattgtccaccgccc
ccagcccccttcccacacaggatcgtggagctgaggaccggaaatgtcaacagtgaattc
agcatgaactcaaaggaggcactgggaggtggcaaatttggagctgtgtgcacctgcacg
gagagagccacaggcctcaagctggcagccaaggtcatcaagaaacagacacccaaggac
aaggaaatggtgttgctggagatcgaggtcatgaaccagctgaaccatcgcaacctgatc
cagctgtacgcagccattgagacctctcacgagatcatcctgttcatggaatacatcgag
ggcggcgagctctttgagaggattgtggatgaagactaccatctgacggaggtggacacc
atggtgttcgtcaggcagatctgcgacgggatcctcttcatgcacaagatgagggtcctg
catctggacctcaagccagagaacatcctgtgtgtgaataccactgggcacttggtgaag
ataattgactttggcttggcgaggaggtataaccccaatgagaaactgaaggtgaatttt
gggaccccggagttcctgtcaccggaggtggtgaactacgaccaaatctctgacaagaca
gacatgtggagccttggggtgatcacctacatgctactgagtggcctctctcccttcctg
ggagacgatgacacggagaccttaaacaatgtcctgtctgccaactggtactttgatgag
gagacctttgaagctgtgtcagatgaggccaaagactttgtctccaatcttctcacgaag
gaccagagtgccagaatgagtgctgagcagtgcctcgcccacccctggctcaacaacctg
gcagaaaaagccaaacgctgcaaccgtcgcctcaagtcccagatcctgcttaagaaatac
ctcatgaagaggcgttggaagaaaaacttcattgctgtcagcgcagccaatcgcttcaag
aagatcagtagctcgggggcactgatggctctgggggtctga

KEGG   Mus musculus (mouse): 238564Help
Entry
238564            CDS       T01002                                 

Gene name
Mylk4, EG238564
Definition
(RefSeq) myosin light chain kinase family, member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    238564 (Mylk4)
   04020 Calcium signaling pathway
    238564 (Mylk4)
   04022 cGMP-PKG signaling pathway
    238564 (Mylk4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    238564 (Mylk4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    238564 (Mylk4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    238564 (Mylk4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    238564 (Mylk4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    238564 (Mylk4)
  09154 Digestive system
   04971 Gastric acid secretion
    238564 (Mylk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    238564 (Mylk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     238564 (Mylk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   238564 (Mylk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Cytochrom_NNT
Motif
Other DBs
NCBI-GeneID: 238564
NCBI-ProteinID: NP_001355809
MGI: 3643758
Ensembl: ENSMUSG00000044951
Vega: OTTMUSG00000000690
LinkDB All DBs
Position
13; 13 A3.2
AA seq 624 aa AA seqDB search
MLKVKRLEEISSCHSSNPLEKVAFFQCMEEVEKVKCFLEENSGDLDLQSGDNEAEENVWS
NRALDERIIVKGGRTSALTEKTDQNDQFSSEKEKITKLNKKNSEKTSALEVQRSCVICHV
ERQDKIEFVQRNSTELRENAGAKDAPCIESLEKQESNNLRDKQDTEDNNGGENGISSKDD
SRGVEAENRASAAASGAVLDKHSTESQHTEDMNGDPSHERCISNIKTTSTPGILGNSASG
STFQNAEQTESTGSSKRRVAEECFLSEDNKKSRIDVVRRGEEPTARTEETRQARSLGDRL
QDGMTTSREQDLEVPLDDIPAPAAPFDHRMVMAKHASVDNLYTVSKSEILGGGRFGQVHK
CEEKATGLKLAAKIIKTRGAKDKEDVKNEISVMNQLDHVNLIQLYDAFESKHDIILVMEY
VEGGELFDRIIDENCNLTELDTILFMKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQ
IKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFSTDMWSVGVITYMLLSGLSP
FLGDNDAETLTNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLS
DHKLHSRLSAQKNCNSGVLNLTTK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggtgaagaggctggaagaaatcagctcgtgccacagcagcaacccgctggag
aaggtggcgtttttccagtgcatggaggaggtggagaaggtgaaatgcttcctggaggag
aattcgggggatctggacctgcagtctggagacaatgaggctgaggaaaatgtatggtcc
aaccgtgcactagatgaaaggataattgtcaaaggaggaaggacatcagccctcacagag
aaaactgaccagaatgaccaattctcttccgagaaagaaaagattaccaaacttaacaag
aaaaattcagagaagaccagtgcattagaagtgcagaggagttgtgtcatatgtcacgtg
gaaagacaagacaagatagaatttgttcagaggaattccacagagctaagagagaatgca
ggtgcaaaagatgctccatgcatagaaagtctggagaaacaagaaagcaacaacctgaga
gataaacaagacactgaagataacaatggaggagaaaatgggatttcttctaaggacgat
tccagaggagtagaagctgagaacagagcttcagcagctgcaagtggagcagtgctagac
aaacactcgactgaaagccagcacactgaggacatgaatggtgacccgtcccatgaaagg
tgcatcagtaatataaagaccacttctacaccaggaatccttggaaattcagcatcagga
tccactttccagaatgctgaacagacagagtctactggcagcagtaagcgcagggtggca
gaggagtgcttcctcagtgaggacaacaaaaagagcagaatagatgtagtgagaagaggg
gaagagcccacagctaggacagaggaaaccaggcaagccagaagcctgggtgatagactc
caggatggaatgaccacctctagagagcaagacctggaggtcccactggatgacatccct
gctcctgccgctccatttgatcatcggatggtaatggccaaacatgcttcagtggacaat
ctgtacaccgtgagcaaatctgagatcctaggaggggggcgttttggtcaggtacataag
tgtgaagagaaagcaacaggcctgaagctggctgctaaaatcattaagactagaggtgca
aaggacaaggaggatgtgaagaacgagatcagcgtcatgaaccagctggaccacgtgaac
ctcattcagctctatgatgcctttgagtccaagcatgacatcatccttgtcatggagtat
gtggagggtggggagctctttgaccgcatcattgatgaaaactgcaacttgacagagctg
gacaccatcctgttcatgaagcagatctgtgaggggatacggtacatgcaccagatgtac
atcctccacttggatctcaagcctgagaacatcctgtgtgtgaatcgggatgctaagcaa
ataaaaattattgattttggattggccagaagatacaagcccagagagaagctgaaggtg
aactttggaaccccagaatttcttgcccctgaagttgtgaactatgatttcgtttccttt
tctacagatatgtggagtgtgggcgtcatcacatacatgctactcagtggcttgtccccc
tttttgggagacaatgatgccgagacactgaccaacatcctggcgtgccggtgggattta
gaagatgaggaatttcaggatatctcggaggaggcaaaggagttcatctccaagctcctg
attaaggagaagagttggagaataagtgccagcgaagctctcaagcacccatggttgtca
gaccacaagctccactccaggctgagtgcacagaagaactgcaactctggtgttctgaac
ctcacgaccaaataa

DBGET integrated database retrieval system