KEGG   Mus musculus (mouse): 107986Help
Entry
107986            CDS       T01002                                 

Gene name
Ddb2, 2610043A19Rik
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04115  p53 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05161  Hepatitis B
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107986 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107986 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    107986 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107986 (Ddb2)
   05202 Transcriptional misregulation in cancer
    107986 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107986 (Ddb2)
   05212 Pancreatic cancer
    107986 (Ddb2)
   05225 Hepatocellular carcinoma
    107986 (Ddb2)
   05226 Gastric cancer
    107986 (Ddb2)
   05214 Glioma
    107986 (Ddb2)
   05216 Thyroid cancer
    107986 (Ddb2)
   05220 Chronic myeloid leukemia
    107986 (Ddb2)
   05217 Basal cell carcinoma
    107986 (Ddb2)
   05218 Melanoma
    107986 (Ddb2)
   05213 Endometrial cancer
    107986 (Ddb2)
   05224 Breast cancer
    107986 (Ddb2)
   05222 Small cell lung cancer
    107986 (Ddb2)
   05223 Non-small cell lung cancer
    107986 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107986 (Ddb2)
   05169 Epstein-Barr virus infection
    107986 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    107986 (Ddb2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    107986 (Ddb2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     107986 (Ddb2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      107986 (Ddb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 107986
NCBI-ProteinID: NP_082395
MGI: 1355314
Ensembl: ENSMUSG00000002109
Vega: OTTMUSG00000014414
UniProt: Q99J79
LinkDB All DBs
Position
2; 2 E1
AA seq 432 aa AA seqDB search
MAPKKCPETQKSPDVAVLLRSKSRRGPQELEPEAKKLRVQGPVSSRTCESCCLLAELSSL
QIPSRSSSIVRDLYQHKLGKATWSSLQQGLQKSFLHSLASYQVFRKAAPFDRRTTSLAWH
PTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGT
TRLQDFKGNILRVYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILLSTDGKELWNLRM
HKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLYSLPHRHPVNAACFSPDG
ARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPN
LKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSQ
EEDGSQKDHERL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaatgcccagaaacccagaagtcccccgacgttgcggtgctcctcagg
agcaaaagtcgcagaggtcctcaggagctggagcccgaagccaagaagctgcgtgtgcag
ggtcccgtttctagcaggacatgtgagtcgtgctgccttctggcagagttgtccagcctg
cagatcccttcacggagtagcagcattgtcagggatctttaccagcataagttgggcaaa
gccacctggtcatcactacagcagggtctgcagaagtcctttttgcactctctagcttct
taccaggtattccgaaaagctgccccctttgacaggaggactacgtccttggcatggcac
ccgactcatcccagtaccctggctgtgggctccaaagggggagatattatgatctggaac
tttggcatcaaggacaaacctatcttccttaaagggattggagctggaggaagcatcact
gggctgaagtttaaccatctcaataccaaccagttttttgcctcctcaatggagggaaca
accaggctgcaggattttaaaggcaacattctcagagtttataccagctcaaactcttgc
aaggtctggttttgcagccttgatgtttctgccaagagcagagtggtggttacaggagac
aatatgggacatgtgatcctgttgagcacagatggcaaggagctttggaacctccgaatg
cacaagaagaaagtagcccacgtggccctgaatccctgctgtgattggcttctggccaca
gcctccatagatcaaacagtgaagatttgggacctgcgccaaattaaagggaaagacagc
ttcctctactcactgcctcacaggcatcctgtcaatgcagcttgttttagcccagatgga
gctcggctcctgactactgaccagaacaatgagattcgggtttactctgcctcccagtgg
gatagccccctgaatctgatctcccaccctcaccgccattttcagcacctcacacccatc
aaggcgacctggcattcacggcacaacctcattgttgtgggccgatacccagatcctaat
cttaaaagttgtgttccctatgaactaaggacaatagatgtgtttgatggaagctcaggg
aagatgatgtgtcagctctatgatccaggatactccggtattacttcgctcaatgagttc
aatcctatgggagacacactggcctctactatgggttatcatattctcatttggagccaa
gaggaagatgggtcacagaaagatcatgaaagactatga

DBGET integrated database retrieval system