KEGG   Mus musculus (mouse): 108989Help
Entry
108989            CDS       T01002                                 

Gene name
Tpr, 2610029M07Rik, C77892
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108989 (Tpr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108989 (Tpr)
  09162 Cancer: specific types
   05216 Thyroid cancer
    108989 (Tpr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    108989 (Tpr)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     108989 (Tpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 108989
NCBI-ProteinID: NP_598541
MGI: 1922066
Ensembl: ENSMUSG00000006005
Vega: OTTMUSG00000029496
UniProt: F6ZDS4
LinkDB All DBs
Position
1; 1 G1
AA seq 2431 aa AA seqDB search
MTSGGSASRSGHRGVPMTSRGFDGSRRGSLRRAGARETASEAADGAAPAAGLRASPCSLA
SPSAAAAVAAIPADMAAVLQQVLERPELNKLPKSTQNKLEKFLAEQQSEIDCLKGRHEKF
KVESEQQYFEIEKRLSQSQERLVTETRECQNLRLELEKLNNQVKVLTEKTKELETAQDRN
LGIQSQFTRAKEELEAEKRDLIRTNERLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKL
DELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNEILELKCNL
ENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLS
NLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKTIQDHLLQVEESKDQMEKEMLEKI
GKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQ
DQLLLEKQENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQ
RLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADI
SSSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENS
LAELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGMAIPLQASSLDDISLLSTPKRSS
TSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYKKEKIDSEKLQNEQLEKLQEQVTD
LRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQERNQKLTATTQKQEQIINTMTQD
LRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGIL
ERSETETKQRLNSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINL
HLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEE
QVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEK
KLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLSTVQNEVQEALQRASTALSNEQQARR
DCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQKAESQLLE
CKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKDAVQAPLNVSL
NEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNVER
EKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKLELDILP
LQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTK
RIQQLNEEVGRLKAEIARSNASLTNNQNLIQSLREDLSKARTEKEGIQKDLDAKIIDIQE
KVKTITQVKKIGRRYKTQFEELKAQQNKAMETSTQSSGDHQEQHISVQEMQELKDTLSQS
ETKTKSLEGQVENLQKTLSEKETEARSLQEQTVQLQSELSRLRQDLQDKTTEEQLRQQMN
EKTWKTLALAKSKITHLSGVKDQLTKEIEELKQRNGALDQQKDELDVRMTALKSQYEGRI
SRLERELREHQERHLEQRDEPQEPTNKAPEQQRQITLKTTPASGERGIASTSDPPTANIK
PTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQ
SEGPVEHVPVFGNASGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPTN
QELSPNIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTMEAGDQVSEDT
VEMPLPKKLKMVTPVGTEEEVMAEESTDGEAETQAYNQDSQDSIGEGVTQGDYTPMEDSE
ETSQSLQIDLGPLQSDQQTTSSQDGQGKGDDVIVIDSDDEDDDEENDGEHEDYEEDEDDD
DDEEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGAESHQRAA
DSQNSGEGNTSAAESSFSQEVAREQQPTSASERQTPQAPQSPRRPPHPLPPRLTIHAPPQ
ELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEA
IHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVP
TTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETAAGDDGDEVFVEAES
EGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTL
RQGVRGRQFNRQRGISHAMGGRGGINRGNIN
NT seq 7296 nt NT seq  +upstreamnt  +downstreamnt
atgacctctggtggctcggcttctagaagtggccacagaggagtacccatgacatcccgg
ggttttgacgggtcccgccgcgggagtctcaggcgggcaggcgcgcgagagaccgcgagc
gaggcggcggacggggcggctccggcggctgggctccgcgcttctccttgctccttggct
tctccttcagccgctgcggctgttgccgcgatcccggccgacatggcggcggtgttgcag
caagtgctggagcgcccggaactgaacaaactgccgaagtcgacgcagaacaaacttgag
aagttcctggccgagcagcagtccgagatcgactgcctgaaggggcggcacgagaaattt
aaggtggagagtgaacaacaatactttgagatagagaagaggctctcacagagtcaggag
aggcttgtcactgaaacccgggagtgtcagaacttgaggctggagcttgagaagctaaat
aaccaagtaaaagtgttaactgaaaaaaccaaagaactggaaactgctcaagaccgtaat
ctgggcattcagagccagtttacaagagcaaaggaagagttagaagctgaaaaaagagat
ttaatcagaaccaatgagaggttatctcaggaagttgaatatttaacagaggatgttaaa
cgtctaaatgaaaaacttaaagaaagcaatacgacgaagggtgaacttcagttaaagctg
gatgaacttcaagcttctgatgttgctgtgaagtatcgagaaaaacgcttagaacaagaa
aaggaattgctacacaatcaaaattcatggctgaacacagagttgaaaaccaaaactgat
gagctgttggctctaggaagagaaaaaggaaatgaaattctggaacttaagtgtaatctt
gaaaacaaaaaagaagaggttctgagactggaagaacagatgaatggcttgaaaacatca
aatgaacatcttcagaaacatgtagaggatttgttgacaaaattaaaagaggccaaagaa
cagcaggccagtatggaagagaaattccacaatgagttaaatgctcacataaagctctct
aatctctacaagagcgctgctgatgactcagaggcaaagagtaatgagctaacccgggca
gtggacgagctgcacaaactgctcaaagaagcaggagaagccaacaaaacaatacaagat
catcttctacaagtggaagaatctaaagatcagatggaaaaagaaatgcttgagaaaata
ggaaaattggagaaggaattagagaatgcaaatgacctgctttctgctacaaaacgtaaa
ggagctatattgtctgaagaagagcttgcagccatgtctcccaccgcagcagctgtagct
aaaattgtaaagcctggcatgaaattaactgagctatataatgcttatgtggaaactcag
gatcagttgcttttggaaaaacaagaaaataaaaggattaataagtatctggatgagata
gtaaaagaagtggaagccaaagcaccgattttgaaacgccagcgcgaagagtatgagcgt
gcacagaaagctgtggccagtctttctgcaaagcttgagcaagctatgaaggagattcag
cgattgcaggaggacactgataaagccaacaaacattcatcggtacttgaaagggacaat
cagagaatggaaatacaaataaaagacctttcgcaacagataagagtgctcttgatggaa
cttgaagaagccaggggtaaccatgtaattcgggatgaggaggtcagctctgctgacatc
agtagttcgtctgaagtgatttcgcagcacctagtatcttacaggaacatcgaagagctt
cagcagcagaatcagcgtctgctattcgctcttcgagaacttggggaaaccagggaacga
gaagagcaagagacaacttcctctaagattgctgaacttcagcataaacttgagaactct
ctcgctgaactggaacagctccgtgagtcacgacaacatcagatgcagcttgttgattcc
atagtgcgtcagcgtgacatgtaccgaattttattgtcacaaacaacaggaatggccatt
cccttacaagcttcaagtttagatgatatttctcttctctcaactccaaaacgttcaagt
acatcacagactgtttccactcctgctccggaacccgtcattgactccacagaggctata
gaagcaaaggctgcccttaaacagttgcaggaaatctttgagaactataaaaaagaaaaa
atagacagtgagaaacttcaaaatgagcagctagagaaacttcaagagcaagtcacagac
ctgcgctcacaaaacaccaaaatttctactcagctagattttgcttctaaacgttatgaa
atgctgcaagataatgtagaaggatatcgtcgagaaataacatctctacaagagagaaat
cagaaactcactgcaactactcagaagcaggaacagatcatcaacacaatgacgcaagac
ttgagaggagccaatgaaaagctagcagttgcagaagtaagagcagaaaatttaaagaag
gaaaaagaaatgcttaaattgtctgaagtccgtctttctcagcaaagagagtctttgtta
gctgaacagagggggcagaacttgttgctgactaatctacagacaatccagggcatacta
gagcgatctgagactgaaaccaaacaaaggctgaatagccagatagaaaaactggagcat
gagatctctcacttgaagaagaaattggaaaacgaggtggaacaaagacatacgcttacg
aggaatctagacgttcaactattagataccaagagacagctagatacagaaataaatctc
catcttaacacaaaagaactgttaaaaaatgctcagaaggacattgctacactgaaacag
caccttaataatatggaagcccagctcgcttcacagtccacacagagaaccggtaaaggt
cagcctggtgacagagatgacgttgatgatcttaaaagtcagctaaggcaggctgaagaa
caggtcaatgacttgaaggagagactcaagacaagtaccagtaatgtggagcagtatcga
gccatggtgaccagcttagaagattccctgaacaaggagaaacaggtgactgaggaggtt
cataagaacattgaagttcgcttgaaagaatcagcagagtttcagacacagttggagaag
aaattgatggaagtagagaaggaaaagcaagaacttcaggatgataagaggaaagccatc
gagagcatggaacagcaattaagtgaattgaagaaaacactgtctactgttcagaatgaa
gtacaagaagctcttcagagagcaagcacagctttaagtaatgaacagcaagccaggcgt
gactgtcaggaacaagctaaaatcgctgtggaagcccagaataagtatgagagagaattg
atgctacatgctgctgatgtcgaagctctgcaagctgccaaggaacaggtttcaaaaatg
acatcaatccgtcagcatttggaagaaacaactcagaaagcagaatcccagttgttggaa
tgtaaagcatcttgggaagagagagagagagtgttgaaggatgaagtttccaaaagtgtg
tctcgctgtgaagatctagagaaacaaaaccgactacttcatgatcaaatcgaaaaatta
agtgacaaggtggtcacctctatgaaggatgctgtgcaagcgccattaaatgtatctctc
aatgaagaagggaaatctcaagaacaaattctagaaattcttagatttattcgacgagaa
aaagaaattgctgaaactaggtttgaggtggctcaggttgagagtttgcggtatcgacaa
agagttgaacttctagaacgggagttgcaagaactgcaggatagcctgaatgtggaaagg
gaaaaggtgcaggtaactgcaaaaacaatggcgcaacatgaagagctgatgaagaaaact
gaaacaatgaacgttgttatggagaccaacaagatgctacgggaggaaaaggaaaggctc
gaacagaacctacaacaaatgcaagccaaggtgaggaaactggagttagacattttaccc
ttacaagaagccaatgctgagctgagtgagaaaagcggtatgctccaggcagaaaagaag
ctactggaagaggatgttaagcgttggaaagcacggaaccagcaactaataaatcaacag
aaagatccagacacagaagaatatcgaaagttgctttctgaaaaggaaattcacactaag
agaatccaacagctaaatgaagaagttggaaggcttaaggctgaaattgcaagatcaaat
gcatccttgactaacaaccagaatttaatccagagtctgcgggaagacttaagtaaagca
cggactgaaaaggaaggcattcagaaagatttagatgccaaaataattgatatacaggaa
aaggtcaaaacaatcactcaagtcaagaaaattggacgcaggtacaagactcagtttgaa
gaactgaaagcgcaacaaaacaaggccatggagacttccactcagtcttcaggagaccat
caggaacagcacatctctgtccaggaaatgcaggagctcaaagataccctcagccaatcc
gaaacaaagacaaagtcacttgagggtcaagtagagaatctgcagaagacattatctgaa
aaagagacagaagcaagaagtctccaggagcagacggtgcagcttcagtctgaactgtca
cgccttcgtcaggacctccaggataaaaccacagaggagcagctccgacagcaaatgaat
gaaaagacttggaagacacttgcactagccaaatcaaaaattacacatctatctggtgtg
aaagatcagctgactaaagaaattgaagaacttaaacaaaggaacggagctctagatcag
cagaaagatgagcttgatgtccgaatgactgctcttaagtcccagtatgaaggtcggatt
agtcgcttagagagagagctcagagagcatcaagagcgacaccttgagcagagggatgag
cctcaagaacccactaataaggctccagaacagcaaagacaaatcacactgaaaaccact
ccagcttctggtgaaagaggaattgccagcacatcagacccaccaacagccaatatcaag
ccaactcctgttgtttctactccaagtaaagtgacagctgcagctatggctgggaataag
tcgacacccagggcaagtatccgcccaatggttacacctgcaacggtcacaaatccgacc
actaccccaacagcaaccgtaatgcctactacacaggtggagtcacaggaagctatgcag
tcagaagggcctgtggaacatgttccagtatttggaaacgcaagtggatctgttcgttct
actagtcctaatgttcagccctccatttctcagcccatcctaactgtacagcagcaaaca
caagctacagcttttgtacaacccactcaacagagccacccgcagattgagcctacaaat
caagaattgtccccaaacatagttgaggtagtacaaagttccccagtggagcgtccatct
acttccacagcagtatttggcactgtttcagctaccccaagttcctccttgccaaagcgc
actcgggaggaggaagaggacagcaccatggaagcaggagaccaagtctctgaggacaca
gtggaaatgcctctcccgaagaagctgaagatggtcacacccgttggaaccgaggaagaa
gttatggcagaagaaagtactgatggagaggcagaaactcaagcctataatcaggactct
caagattccattggagaaggagttacccagggagattatacaccaatggaagacagtgaa
gaaacatcacaatctctacaaatcgatcttggaccacttcagtcagatcaacagactact
tcctctcaagatggtcaaggcaaaggagatgatgtaattgtaattgacagtgatgatgaa
gatgatgatgaagaaaatgatggcgaacatgaagattatgaagaagacgaagatgatgat
gatgatgaagaagatgacacggggatgggagatgagggtgaagatagtaatgaaggaact
ggtagtgcagatggtaatgatggatatgaagctgatgatgctgagggtggtgatgggact
gatccaggtacagaaacagaagaaagtatgggtggagctgaaagtcatcagagagctgct
gattctcaaaacagtggtgaaggaaatacaagtgcagcagagtcttccttctctcaggag
gttgccagggaacagcagcccacgtcagcgtctgagagacagactccgcaagcaccgcag
tcaccaaggcgccctccacatcctctccccccacgcctgaccattcacgccccacctcag
gagctgggaccaccagttcagagaattcagatgacccggaggcagtctgtagggcgtggt
cttcagttgactccaggaataggtggcatgcaacaacacttttttgatgatgaagacaga
acagtcccgagtaccccaactcttgtggtgccacatcgcactgatgggtttgctgaagct
attcattccccacaggttgccggtgttcctagattccggtttgggccacctgaagacatg
ccacagacaagttccagtcactctgatcttggccaacttgcttctcaaggaggtttggga
atgtatgaaacacccctttttctggctcatgaagaagagtctggtggccgcagcgttccc
actacgcctctccaagtagcagccccagtgactgtgttcactgagagtaccacctctgat
gcttcagaacatgcctctcagtcggttcccatggtgacaacgtctacgggcactttatcc
acgacaaacgaaacagcagcaggtgacgacggagatgaagtatttgtagaggcggagtct
gaaggtattagttcagaggcaggcctagaaattgatagccagcaggaagaggagcctgtc
caagcatctgatgaatcagatcttccctcaaccagccaagatcccccttcgagctcctcc
gtagataccagtagtagtcaaccgaagcctttcagacgagtaagacttcagacaaccttg
agacagggtgttcgtggtcgtcagtttaaccgacaaagaggtataagccatgcaatggga
ggaagaggaggaataaatagagggaatattaattaa

KEGG   Mus musculus (mouse): 18211Help
Entry
18211             CDS       T01002                                 

Gene name
Ntrk1, C80751, Tkr, TrkA, trk
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18211 (Ntrk1)
   04010 MAPK signaling pathway
    18211 (Ntrk1)
   04151 PI3K-Akt signaling pathway
    18211 (Ntrk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18211 (Ntrk1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18211 (Ntrk1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18211 (Ntrk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18211 (Ntrk1)
   05202 Transcriptional misregulation in cancer
    18211 (Ntrk1)
   05230 Central carbon metabolism in cancer
    18211 (Ntrk1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    18211 (Ntrk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18211 (Ntrk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18211 (Ntrk1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18211 (Ntrk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 LRR_8 I-set Ig_3 Ig_2 TrkA_TMD LRR_4 C2-set_2
Motif
Other DBs
NCBI-GeneID: 18211
NCBI-ProteinID: NP_001028296
MGI: 97383
Ensembl: ENSMUSG00000028072
Vega: OTTMUSG00000051890
UniProt: Q3UFB7
LinkDB All DBs
Position
3 F1; 3 38.62 cM
AA seq 799 aa AA seqDB search
MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGPSGLRCTRAGSLDTLR
GLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHL
NLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGP
GDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADWILTELEGAATV
KKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGLAVEQHH
WCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFG
VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLS
PTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQD
KMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDL
NRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCL
VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVL
WEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDV
HARLQALAQAPPSYLDVLG
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggccagcggctcgggcagctgggctggcatcgcccggccgcggggctaggc
agtctgatgacttcgttgatgctggcctgtgcctccgccgcatcctgtcgcgaggtctgc
tgtcccgtgggcccctcggggctgcgctgcaccagggcagggtccctggataccctccgc
ggcctgcggggcgccgggaacctgacggagctctacgtggaaaaccagcagcacctgcaa
cgcttggagtttgaggacctgcagggcctgggggagttgagaagcctaaccatcgtgaag
agtggcctccgctttgtggccccagatgccttccgtttcacccctcggctcagtcacctg
aatctgtcctccaatgcgttggagtccctctcctggaaaactgtgcagggcctctcccta
caggacctgaccctgtcagggaacccactgcattgttcctgtgccctgttctggctccag
cgttgggagcaggaagggctgtgtggtgtgcatacacagacgcttcatgactctgggcct
ggagaccagttcctcccactgggacacaacaccagttgtggtgtacccacagtgaagatc
cagatgcccaatgactctgtggaagtgggcgatgacgtgtttctgcagtgccaggtggag
gggctggccctacagcaggctgactggatcctcacagagctggaaggggcagccaccgtg
aagaaatttggagatctgccatccctggggctgattctggtcaatgtcaccagtgatctc
aacaagaagaatgtgacgtgctgggcagagaatgatgtgggccgggccgaggtctctgtc
caagtcagcgtctccttcccagccagtgtgcacctgggcctagcggtggagcagcatcat
tggtgcatccccttctcggtggacgggcagccagcaccgtctctgcgctggttgttcaac
ggctctgtgctcaacgagaccagtttcatcttcactcagttcttggagtctgcgctgact
aatgagaccatgcggcacggctgcctgcgcctcaatcagcccacgcatgtcaacaacggg
aactacaccctgctggcggccaacccctacggccaggctgccgcctccgtcatggctgct
tttatggacaacccttttgagttcaaccctgaggaccccatccctgtctccttctcgcca
gtggacggtaacagcacatcaagagacccagtggagaagaaagatgaaaccccttttggg
gtctctgtggctgtgggcctagccgtctctgccgccctcttcctttctgccctccttctt
gtgctcaacaaatgtggacagaggagcaaatttgggatcaaccgccctgctgtattagct
ccagaggatgggctggccatgtccctacacttcatgacactgggtggcagttctctttcc
cctactgagggcaaaggctccggactccagggccacatcatggagaacccacagtacttc
agtgatacctgtgtccatcacatcaagcgccaggacatcattctcaagtgggagctaggg
gagggagcctttggaaaggtctttctcgctgagtgctacaaccttctgaatgatcaggac
aagatgctcgtggctgtcaaggcactgaaggaggcatccgagaatgctcggcaggacttt
cagcgtgaggccgagctgctcaccatgctacagcaccagcacatcgtgcgcttctttgga
gtctgcaccgagggtggcccgttgctcatggtctttgagtacatgcgccacggggacctc
aaccgtttcctccggtcccacggacctgatgcaaagctgctggctggtggtgaggatgtg
gctcctggtcctctgggccttgggcagcttctggctgtggctagccaggtggctgctggt
atggtatatctagccagcctgcactttgtgcaccgggatctggccacacgcaactgtctg
gtgggtcagggactagtggtgaagattggagactttggcatgagcagagacatctatagc
acagactattaccgagtgggaggtcggaccatgctgcccatccgctggatgccacccgag
agcatcctctaccgcaagttcagcaccgagagcgatgtgtggagctttggggtggtgctc
tgggagatcttcacctatggaaagcagccctggtaccagctctccaacactgaggcgatc
gagtgtatcacgcagggccgggagctggagcggccgcgcgcctgccctcctgatgtctac
gccatcatgcgaggctgctggcagcgagaaccgcagcaacgcctcagcatgaaggatgtg
cacgcgcgtctgcaggccctggcacaggcgccacccagttacctggacgttctgggctag

KEGG   Mus musculus (mouse): 21787Help
Entry
21787             CDS       T01002                                 

Gene name
Tfg, AI173908
Definition
(RefSeq) Trk-fused gene
  KO
K09292  protein TFG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21787 (Tfg)
  09162 Cancer: specific types
   05216 Thyroid cancer
    21787 (Tfg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1
Motif
Other DBs
NCBI-GeneID: 21787
NCBI-ProteinID: NP_001239372
MGI: 1338041
Ensembl: ENSMUSG00000022757
Vega: OTTMUSG00000026667
UniProt: Q8C2C6
LinkDB All DBs
Position
16; 16 C1.1
AA seq 348 aa AA seqDB search
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFDTVDGREEKPAASDSSGKQSTQVMAASMSAF
DPLKNQDEINKNVMSAFGLTDDQVSGPPSAPTEDRSGTPDSIASSSSAAHPAVQPQQPPY
AGAQTQAGQIEGQMYQQYQQQAGYSAQQPQAPPQQYGVQYSASYSQQTGPQQPQQFQGYG
QQPTSQAPAPAFSGQPQQLPAQPPQQYQASTYPPQTYTTQPSQPANYTVPPGSQPGMAPS
QPGAYQPRPGFTPSPASTMTPPSSGANPYARNRPPFGQGYAQPGPGYR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacagttggacctaagtgggaagctgattatcaaagctcaacttggggaagat
atccgacgaattcccattcataatgaagacattacttacgatgaattagtgctaatgatg
cagcgagtattcagaggaaagcttctgagtaatgatgaagttacaataaagtataaggat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgt
agtagaatactgaaactgacattatttgatactgtggatggcagggaagagaagcctgcc
gcttctgactcttctgggaaacagtcaactcaggttatggcagcaagtatgtcagctttt
gatcctctgaaaaaccaagatgaaatcaacaaaaacgtcatgtcagcatttggattaaca
gatgaccaggtttcaggcccacccagtgcccctacagaagaccgctccggaacacctgac
agcattgcttcttcctcctcagcagcacacccagcagttcagccgcagcaacctccctat
gcaggagctcagacacaagcaggtcagattgaaggtcagatgtaccagcagtaccagcag
caggctggctacagtgcccagcagcctcaggcccctcctcagcagtatggtgttcagtac
tcagctagttacagccagcagactggaccccaacaacctcagcagttccagggatatggc
caacaaccaacttcccaggcaccggctcctgccttttctggccagccacaacaactgcct
gctcaaccaccacagcagtaccaggcgagcacttaccctccacaaacgtatactacccaa
ccatctcagcctgccaactatactgttccccctggctctcagcctggaatggctccaagc
caacctggtgcttaccaaccaagaccaggttttacgccatctcctgcaagtaccatgacc
cctccttctagtggggctaacccttatgctcgtaaccgtcctccttttggtcaggggtat
gcccaacctggacctggttatcgataa

KEGG   Mus musculus (mouse): 59069Help
Entry
59069             CDS       T01002                                 

Gene name
Tpm3, TM30nm, TMnm, Tm5NM, Tpm-5, Tpm5, Trop-5, gamma-TM, hTM30nm, hTMnm
Definition
(RefSeq) tropomyosin 3, gamma
  KO
K09290  tropomyosin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    59069 (Tpm3)
   04261 Adrenergic signaling in cardiomyocytes
    59069 (Tpm3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    59069 (Tpm3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    59069 (Tpm3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    59069 (Tpm3)
   05414 Dilated cardiomyopathy (DCM)
    59069 (Tpm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    59069 (Tpm3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     59069 (Tpm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM XhlA DUF745 HrpB7 ATG16 DUF3450 CENP-F_leu_zip DHR10 DUF1664 Golgin_A5 MscS_porin SlyX Laminin_I AAA_13 EzrA Spc7
Motif
Other DBs
NCBI-GeneID: 59069
NCBI-ProteinID: NP_001280677
MGI: 1890149
Ensembl: ENSMUSG00000027940
Vega: OTTMUSG00000029647
UniProt: P21107
LinkDB All DBs
Position
3; 3 F1
AA seq 285 aa AA seqDB search
MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaagagaatgttctg
gaccgagctgagcaagctgaagctgagcagaaacaggcagaagaaagaagcaagcagcta
gaggatgaactagcaaccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattcggaagctttaaaggatgctcaggagaagctggagctagcagagaagaaggcagcc
gacgctgaagctgaggtggcctccttgaaccgcaggatccagctggttgaagaggagctg
gaccgtgcgcaggagcgccttgccactgctttgcagaagctggaggaagcagagaaggct
gctgatgagagtgagagaggtatgaaggtgattgaaaatcgggctctaaaagatgaagaa
aagatggaactccaggaaatccagctaaaggaagcaaagcacattgcagaagaggccgat
aggaagtatgaagaggtggctcgtaagttggtgattattgaaggagacttggaacgcacg
gaggaacgtgctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagac
aagtatgaagaagaaataaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgaaagatcggtagccaagctggagaagaccattgatgacctggaagacgag
ctctatgcccagaaactgaagtacaaggccattagcgacgagctggaccacgccctcaat
gacatgacctctatataa

DBGET integrated database retrieval system