KEGG   Mus musculus (mouse): 110279Help
Entry
110279            CDS       T01002                                 

Gene name
Bcr, 5133400C09Rik, AI561783, AI853148, mKIAA3017
Definition
(RefSeq) breakpoint cluster region
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110279 (Bcr)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110279 (Bcr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    110279 (Bcr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    110279 (Bcr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110279 (Bcr)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BCR family
   110279 (Bcr)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    110279 (Bcr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF C2 PH IQ_SEC7_PH
Motif
Other DBs
NCBI-GeneID: 110279
NCBI-ProteinID: NP_001074881
MGI: 88141
Ensembl: ENSMUSG00000009681
UniProt: Q6PAJ1 A2RRK7
LinkDB All DBs
Position
10 C1; 10 38.49 cM
AA seq 1270 aa AA seqDB search
MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRASAPRPPPAPADGADPAPVEESEARPDGE
GSPSKGRSASARRPAAAASADRDDRGPPTSVAALRSNFEKIRKGPAQPGSADAEKPFYVN
VEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQQSAGQGLGEAPRPHYRGRSSESS
CGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPYQSIYVGGMMVEGEGKSPLLR
SQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPT
TYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPSDG
DSTFQGEADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGA
LDPTKVSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQ
QIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVA
METAEKCCQANAQFAEISENLRARSNKDVKDSTTKNSLETLLYKPVDRVTRSTLVLHDLL
KHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEG
ARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEALPNIPLVPD
EELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNG
KSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINK
EDDESPGLYGFLHVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEE
FEIELEGSQTLRILCYEKCYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVID
MNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERR
GMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFT
DEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLH
NLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSK
RQSILFSTEV
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atggtggactcggtgggcttcgccgaggcgtggagggcgcagttcccggactcggagccg
ccgcgcatggagctgcgctcggtgggtgacatcgagcaggagctggagcgctgcaaggcc
tccattaggcgcttggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgctgctggccaaggagaagaagagctacgatcggcagcgctggggcttccgccgtgca
gcgcagccccccgacggcgccgccgagccccgagcgtccgccccgcgcccgccgcccgcg
cccgccgacggcgcagacccggcgcccgtcgaggagtccgaggcgcggccggacggagag
gggtcaccgagtaaggggcggtcagcgtccgcccgcaggccagcggctgctgcatcggcg
gaccgggacgaccgagggccccccaccagcgtggcggcgctcagatccaacttcgagaag
atccgcaagggacctgcccagcccggctctgccgacgccgagaagcccttctacgtgaac
gtcgagttccaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtccgaccga
atcagttccctgggcagccaggccatgcaaatggagcgcaagaagtcccagcagagcgcc
gggcagggcctgggggaagcacccagaccccattaccgtgggcgctcctcggaaagcagt
tgcggccttgacggtgactatgaggatgcagagttgaatccccgcttcctgaaggacaac
ctaataaatgccaacggcggcaacaggcccccttggccgcccctggagtaccaaccctac
cagagcatctatgtcggaggcatgatggtggaaggggagggcaagagccctctcctgcga
agccagagcacttcagagcaggagaaacgcctaacctggcctcgcaggtcctactcgcct
cggagtttcgaggacagcggaggtggctacacgccggactgcagctccaacgagaacctc
acctccagcgaggaggacttttcctctggccagtccagccgcgtgtcaccaagccccacc
acctaccgcatgttccgggacaagagccgctcaccctcgcagaattcgcagcagtccttt
gacagcagcagccccccgacgccacagtgccagaagcggcaccggcagtgccaggttgtg
gtgtctgaggctaccatcgtgggtgtccgcaagactgggcagatctggcccagtgatggg
gacagcacctttcaaggggaagcagattcctcgtttggaacaccacctggatatggctgt
gccgcagaccaggctgaggaacagcgccggcaccaggacgggctgccctacatcgatgat
tcaccttcttcctcgccacacctcagcagcaaaggcagaggcagcctggcctcaggcgcc
ctggatcccaccaaagtgagtgagctggatctggaaaagggcctggagatgagaaagtgg
gttttgtccggaatcctggccagcgaggagacgtacctgagccatctggaggccctgctg
ctgcccatgaagcctctgaaagccgctgccaccacctctcagcctgtgctgaccagccag
cagattgagaccattttcttcaaagtgcctgagctctacgagatccacaaggagttctac
gatgggctgttcccccgagtgcagcagtggagccaccagcagcgtgtaggggacctcttc
cagaagctggccagccagctgggtgtgtaccgagcctttgtggataactacggagtggcc
atggaaactgcagagaagtgctgtcaggccaacgctcagtttgcagaaatctctgagaac
ctgcgagccagaagcaacaaggatgtcaaggactcaactaccaagaactctttggaaact
ctgctctacaaacctgtggaccgggtgacgaggagcacgctagtccttcacgacttgcta
aaacacaccccgtccagccatcccgaccattccctgctgcaagacgccctccgaatctct
cagaacttcctgtccagcatcaacgaggagatcacgccccgccgacagtccatgacggtg
aaaaaaggagagcaccggcagctgctgaaggacagctttatggtagagctggtggagggg
gcccgcaagctgcgtcacatcttcctgttcactgacctgctcctctgcaccaagctgaag
aagcaaagtggaggcaaaacccagcaatatgactgtaaatggtacattccgctcacggac
ctcagcttccagatggtggatgaattggaggcactacccaacatccctctggtgccagat
gaggaactggatgccttgaagatcaaaatctcccaaatcaagagcgacatccaacgagag
aagagagcaaataagggcagcaaggtcatggagaggctgaggaagaagctgtcagagcag
gagtcactgctgctgttaatgtctcccagcatggccttccgcgttcacagtcgcaacggc
aagagttacacgttccttatttcctctgactatgagcgagccgagtggagagaaagcatc
cgagagcagcagaagaaatgtttcaaaagtttctctctgacatctgtggagctacaaatg
ctgaccaactcatgtgtaaaacttcagacggttcaccacattccactgaccatcaacaaa
gaagatgacgagtctcctggactctacggcttcctgcatgtcatcgtccactcagccacc
ggctttaagcagagctcaaatctctactgcaccctggaggtggattcctttggatatttt
gtgaataaagcaaagactcgagtctacagggacacaactgagccaaactggaatgaggag
tttgagatagagctagaaggctcccagaccctgcggatactatgttatgaaaagtgttac
aacaaaatgaagatgacgaaggaagatggtgagagcgcagacaagctcatggggaaaggc
caggtccagctggacccccaaaccctacaggacagagactggcagcggactgtcatcgac
atgaatggaattgaagtgaaactctccgtcaagttcacgagcagggagttcagcctgaag
agaatgccctcccgcaaacagacaggggtcttcggtgtcaagattgctgtagtcacaaag
agagagaggtccaaggtaccttacattgtgcgccagtgtgtggaagagatcgagcgccgg
ggtatggaggaggtgggcatctaccgagtgtctggagtggccacagacatccaggcactg
aaggcagcctttgatgtcaataacaaggatgtgtccgtgatgatgagcgagatggacgtg
aacgccattgccggcacgctgaagctctacttccgtgagctgcccgagcccctcttcacg
gatgagttctaccctaacttcgcagaaggcattgctctttcagaccccgtcgcaaaggag
agctgcatgctgaacctgctgctgtccctcccagaagccaacctgctcaccttcctcttc
ctcctggaccacctgaaaagggtagctgaaaaggagacggtgaacaagatgtccctgcac
aacctcgccacggtctttggccccacactgcttcggccctcagagaaggaaagcaagctc
cctgctaaccccagccagcccatcaccatgactgacagctggtccctggaggtcatgtcc
caggtccaagtgttgctgtacttcctgcagctggaggccatccctgcccctgacagcaag
agacagagcatcctgttttccactgaagtctaa

KEGG   Mus musculus (mouse): 11350Help
Entry
11350             CDS       T01002                                 

Gene name
Abl1, AI325092, Abl, E430008G22Rik, c-Abl
Definition
(RefSeq) c-abl oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04110  Cell cycle
mmu04360  Axon guidance
mmu04722  Neurotrophin signaling pathway
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05220  Chronic myeloid leukemia
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11350 (Abl1)
   04012 ErbB signaling pathway
    11350 (Abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    11350 (Abl1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11350 (Abl1)
  09158 Development and regeneration
   04360 Axon guidance
    11350 (Abl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11350 (Abl1)
   05206 MicroRNAs in cancer
    11350 (Abl1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    11350 (Abl1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    11350 (Abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11350 (Abl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     11350 (Abl1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ABL family
   11350 (Abl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11350
NCBI-ProteinID: NP_033724
MGI: 87859
Ensembl: ENSMUSG00000026842
Vega: OTTMUSG00000012077
UniProt: P00520
LinkDB All DBs
Structure
PDB: 

Position
2 21.86 cM; 2 B
AA seq 1123 aa AA seqDB search
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAE
QKDAPDTPELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLF
SALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPK
ASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASC
MPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAM
PPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSAS
GMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACT
GKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQS
TAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTI
TKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAI
NKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgttggagatctgtttgaagttggtgggctgcaaatccaagaaggggctctcttcgtcc
tccagctgctacctggaagaagccctgcagaggccagtggcatctgactttgagccccag
ggtctcagcgaagcagctcgatggaactccaaggaaaaccttcttgctgggcccagtgaa
aatgaccccaacctttttgtggcactctatgattttgtggccagtggagataacactctc
agcatcactaaaggtgaaaagctccgggtcttgggttataatcacaatggggaatggtgt
gaagcccaaacgaaaaatggccaaggatgggtcccaagcaactacatcacccccgtcaac
agcctggagaaacattcctggtatcatggccctgtatctcggaatgctgctgagtatctg
ctgagcagcggaatcaacggcagcttcttagtgcgggagagtgagagtagccctggccag
agatccatctcgctgcggtatgaagggagggtgtaccactacaggatcaacactgcctct
gatggcaagctgtacgtgtcctccgagagccgcttcaacactctggctgagttagttcac
catcactccacggtggctgatggcctcatcaccacactccactacccagctcccaagcgc
aacaagcccactatctacggtgtgtcccccaactacgacaagtgggaaatggagcgcacc
gacatcaccatgaagcacaagttgggtggaggccagtacggggaggtgtacgagggcgtt
tggaagaagtacagcctcactgtggccgtgaagaccttgaaggaggacaccatggaggtg
gaggagttcctgaaggaagcggcggtgatgaaggagatcaaacaccctaacctggtgcag
ctgctaggggtgtgtacccgggaaccaccattctacataatcactgagttcatgacctat
gggaacctgctggactacctgagggagtgtaaccggcaggaggtgagcgccgtggtactg
ctctacatggccacacagatctcatcagccatggagtacttggagaagaagaacttcatc
cacagagaccttgctgcccggaactgcctggtaggggaaaaccacttggtgaaggtggct
gattttggcctgagcaggttgatgacaggggacacctacacggcccatgctggagccaaa
ttccccatcaaatggaccgcacctgagagcctggcctacaacaagttctccatcaagtcg
gacgtgtgggcatttggagtattgctctgggagattgctacctatggcatgtcaccttac
ccgggaattgacctgtctcaggtttatgagctgctggaaaaagactaccgcatggagcgc
cctgaaggctgcccggagaaggtctacgagctcatgcgagcatgttggcagtggaacccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaaccatgttccaggaatcc
agtatctcagatgaggtggagaaggagctggggaaacgaggcacgagaggaggtgctggg
agtatgctgcaggccccagagctgcccaccaagaccagaacctgcaggagagcagctgag
cagaaagatgcgcctgacacccctgagctgctccacacgaagggcctgggagaaagcgat
gcactggacagtgagcctgctgtatcgccactgcttcctcggaaagagcgcgggccccca
gacggcagcctaaatgaagatgagcgccttctccccagagacagaaagaccaacctgttc
agcgctttgatcaagaagaagaagaaaatggcgccgacgccccctaagcgcagcagttcc
ttccgagagatggatggccagccagaccgcagaggggctagtgaggatgacagcagggaa
ctctgcaatggaccaccagctctcacctcagacgcagcagagcctaccaagtccccaaag
gccagcaatggggctggcgtccctaatggagccttccgggagccgggcaactcaggcttc
cgttctccccacatgtggaaaaagtccagcacactgaccgggagccgcctggctgctgcc
gaagaggagagcggcatgagctccagtaagcgcttcctgcgttcttgttcggcctcctgc
atgccccatggggcaagggacacagagtggcggtcggtcacgctgcctcgagacctgccg
tctgctggcaagcagtttgactcatccacctttggagggcacaaaagcgaaaagccagct
ctgcctcggaaacgcaccagtgagagcaggtctgagcaggtggccaaaagcacggcgatg
ccccctccccggctggtgaagaagaacgaggaggctgctgaagaaggcttcaaagacaca
gaatccagccctggctccagccctcccagcttgactcccaaactcctccgcaggcaggtc
actgcctctccttcctctggcctctctcacaaggaagaggccaccaagggcagtgcctca
ggcatggggactccggccactgcagagccagcaccccccagcaacaaagtgggcctcagc
aaggcctcctctgaggagatgcgcgtaaggaggcacaagcacagctcggagtccccaggg
agagacaaggggcgactggctaagctcaagcctgccccgccgcctcctcctgcctgcaca
ggaaaagcaggcaagcccgcacagagccccagccaagaggccggggaggcaggggggccc
acaaagacaaaatgcacgagtctggctatggatgctgtgaacactgaccccaccaaggcc
ggcccacctggagaaggactgagaaagcctgtgcccccatctgtgccaaagccccagtcg
acggctaagcctccagggactcccaccagcccggtctccaccccctccacagcaccagct
ccttcacccctggctggggaccagcagccatcttctgccgccttcatccccctcatatca
acccgtgtgtctcttaggaagacccgccagccgccagagcgcattgccagtggcaccatc
accaagggtgtggttctggacagtactgaggccctgtgccttgccatctcccggaactca
gagcagatggccagccacagtgctgtactggaggctggcaagaacctgtacactttctgt
gtgagctatgtggactctatccagcagatgaggaacaagtttgccttccgtgaggctatc
aacaagctggagagcaacctccgagagctgcagatctgccctgccacagcctccagtggg
ccagctgccacccaagacttcagcaagctgctcagctctgtgaaggagatcagcgacatt
gtccggaggtag

DBGET integrated database retrieval system