KEGG   Mus musculus (mouse): 111173Help
Entry
111173            CDS       T01002                                 

Gene name
Erc1, 4930404L01Rik, 5033405M01Rik, 9630025C19Rik, B430107L16Rik, CAST2, ELKS, Elks1, RAB6IP2A, RAB6IP2B, Rab6ip2, mKIAA1081
Definition
(RefSeq) ELKS/RAB6-interacting/CAST family member 1
  KO
K16072  ELKS/RAB6-interacting/CAST family member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111173 (Erc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    111173 (Erc1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Others
   Others
    111173 (Erc1)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    111173 (Erc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cast PKcGMP_CC DUF5486 DUF111 DUF5617 Baculo_gp64 Pro-kuma_activ
Motif
Other DBs
NCBI-GeneID: 111173
NCBI-ProteinID: NP_835186
MGI: 2151013
Ensembl: ENSMUSG00000030172
Vega: OTTMUSG00000044533
UniProt: Q99MI1
LinkDB All DBs
Position
6; 6 F1
AA seq 368 aa AA seqDB search
MDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIW
KEQYRVVQEENQHMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLH
AEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHE
RTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHRRFENAPDSAKTKALQTVIEMKDSKI
SSMERGLRDLEEEIQMLKSNGALSSEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKD
TELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVKSFCDLCRIQSIPSF
ILLYICYV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcagacacagctgaaggaagtattaagagaaaacgatcttttgaggaaagat
gtggaagtaaaggagagcaaattaagttcatcaatgaatagtatcaagaccttctggagc
ccagagttaaagaaagagcgggccttgagaaaagatgaagcttccaaaatcaccatttgg
aaggagcagtaccgagttgtacaggaggaaaaccagcacatgcagatgacaatccaggct
ctccaggatgagctgcggatccagagggacttgaatcagctgtttcagcaagatagcagc
agtaggactggggagccttgcgtggcagagctcacagaggagaacttccagaggctgcat
gctgagcacgagaggcaagccaaagagctgtttcttctgcggaagaccctggaggaaatg
gagctgaggattgagactcagaagcagaccctaaatgctcgggatgagtccatcaagaag
cttctggagatgctccagagcaaaggactttctgccaaagctacagaggaagaccatgag
agaacgcgacggctcgcagaggcggagatgcacgtccaccacctcgagagtcttttggag
cagaaggaaaaagagaataatatgttgagagaggagatgcaccggagatttgaaaatgcc
cctgattctgccaagacaaaagccttgcaaactgttattgaaatgaaggattcaaaaatt
tcttccatggagcgtgggctccgagacctggaagaggaaattcagatgctgaagtcaaat
ggggctttgagtagtgaggagcgggaggaagagatgaagcaaatggaggtgtacaggagc
cactcaaagtttatgaaaaataagattggccaggtgaaacaggaactgtccagaaaggac
acagaattactagccttacaaacaaagctagaaactctcacgaaccaattctcagacagt
aagcaacatattgaggtgctgaaagagtccctcactgctaaggagcaaagggctgccatc
ctacagactgaggtaaagagtttttgtgatttgtgtagaatccagtccatacctagtttc
attttgttatatatttgttatgtttag

DBGET integrated database retrieval system