KEGG   Mus musculus (mouse): 112405Help
Entry
112405            CDS       T01002                                 

Gene name
Egln1, AI503754, C1orf12, HIF-PH2, HPH-2, Hif-p4h-2, ORF13, Phd2, SM-20
Definition
(RefSeq) egl-9 family hypoxia-inducible factor 1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112405 (Egln1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112405 (Egln1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112405 (Egln1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112405 (Egln1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 zf-MYND 2OG-FeII_Oxy_4 zf-Mss51
Motif
Other DBs
NCBI-GeneID: 112405
NCBI-ProteinID: NP_444437
MGI: 1932286
Ensembl: ENSMUSG00000031987
Vega: OTTMUSG00000061572
UniProt: Q91YE3
LinkDB All DBs
Position
8; 8 E2
AA seq 400 aa AA seqDB search
MASDSGGPGVLSASERDRQYCELCGKMENLLRCGRCRSSFYCCKEHQRQDWKKHKLVCQG
GEAPRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSAAASRVPGPEDAAQARSGPGPAE
PGSEDPPLSRSPGPERASLCPAGGGPGEALSPGGGLRPNGQTKPLPALKLALEYIVPCMN
KHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDQITWIEGKE
PGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRC
VTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATR
YAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgacagcggcgggcccggcgtgctgagcgccagcgagcgcgaccggcagtac
tgcgagctgtgcgggaagatggagaacctgctgcgctgcggccgctgccgcagctccttc
tactgctgcaaagagcaccagcgccaggactggaagaagcacaagctggtgtgccagggc
ggcgaggccccccgcgcgcagcccgcgccggcgcagccccgcgtcgcgcccccgcccggt
ggggcccccggagccgcgcgcgccggcggggcggcccggcgcggggacagcgcggcggcc
tcgcgcgtaccgggcccggaggacgcggcgcaggcccggagcggccccggcccagcagag
cccggctccgaggatcctccgcttagccggtctccgggccccgagcgcgccagcctgtgc
ccagcgggtggcggccccggggaggcgctgagtcccggtggagggctgcggcccaacggg
cagaccaagccgttgcccgcgttgaagctggctctggagtacatcgtgccgtgcatgaac
aagcacggcatctgcgtggtggacgacttcctgggcagggagaccgggcagcagatcggc
gatgaggtgcgcgccctgcacgacaccggcaagttcacggacgggcagctggtcagccag
aagagtgactcttccaaggacatccggggggaccagatcacctggatcgagggcaaagag
cccggctgcgaaaccatcggcctgctcatgagcagcatggacgacctgatccgccactgc
agcgggaagctgggcaactacaggataaacggccgaacgaaagccatggttgcttgttac
ccaggcaacggaacaggctatgtccgtcacgttgataacccaaatggagatggaagatgc
gtgacatgtatatattatctaaataaagactgggacgccaaggtaagtggaggtattctt
cgaatttttccagaaggcaaagcccagtttgctgacattgaacccaaatttgatagactg
ctgtttttctggtctgaccggcgtaaccctcatgaagtacagccagcatacgccacaagg
tacgcaataactgtttggtattttgatgcagatgagcgagcgagagctaaagtaaaatat
ctaacaggtgagaaaggtgtgagggttgaactcaagcccaattcagtcagcaaagacgtc
tag

KEGG   Mus musculus (mouse): 112406Help
Entry
112406            CDS       T01002                                 

Gene name
Egln2, 0610011A13Rik, C85656, Hif-p4h-1, Ier4, Phd1, SM-20
Definition
(RefSeq) egl-9 family hypoxia-inducible factor 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112406 (Egln2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112406 (Egln2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112406 (Egln2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112406 (Egln2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Motif
Other DBs
NCBI-GeneID: 112406
NCBI-ProteinID: NP_444438
MGI: 1932287
Ensembl: ENSMUSG00000058709
Vega: OTTMUSG00000023172
UniProt: Q91YE2 Q80X29
LinkDB All DBs
Position
7 A3; 7 15.83 cM
AA seq 419 aa AA seqDB search
MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPAYHRPGASGEASAGNG
TPRTTATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRK
WAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSSSSNTTSSSGEASARLREE
VQPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQR
AIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGNYVINGRTKAMVACYP
GNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLL
IFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVPVSQPTTPT
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcaggccctgaatcaagctctccctcagttgccagggtct
gtgtcagagtccttggagtctagccgagccagaatgggggtggagagttacctgccctgc
cctctgctcccggcctatcaccgtccaggagcatctggggaggcctcggctggcaatggg
acccccagaaccacagccactgctactacgaccactgccagtcccctgcgggagggcttt
ggtgggcaggatggtggtgagctttggccactgcagagtgaaggtgctgctgcgttggtc
accaaggagtgccagcgactggcggcccagggtgcccggcctgaggcccccaaacggaag
tgggccaaggatggtggggatgccccttcacccagcaagcgaccgtgggccaggcaagag
aaccaggaggccaagggggaaagtggtatgggctgtgacagcggtgccagcaacagcagc
agcagcagcagcaacactaccagtagcagtggcgaggcaagtgctaggctgagggaggaa
gtccagccctctgcacctgagcgcctggccctggactatattgtgccttgcatgcggtac
tatggtatctgtgtcaaggacaacttcttgggggcagtactgggtggccgtgtgctggct
gaggtggaagccctgaagtggggcgggcgtcttcgtgatgggcaactagtgagccagcgg
gcgatcccaccgcgcagcattcgtggggaccagattgcctgggtagaaggtcacgagcca
ggctgccggagcattggtgccctcatggctcacgtggacgcagtaatccgccactgtgca
gggcggctgggcaactacgtcatcaatgggcgcaccaaggccatggtggcgtgttatcca
ggcaatgggctcgggtacgtgaggcatgttgacaatccccacggcgatgggcgctgcatc
acctgtatctattacctgaatcagaactgggatgttaaggtgcatggcggcctgctgcag
atcttccccgagggtcggccagtggtagccaacatcgagccactctttgaccggttgctc
attttctggtctgaccgacggaacccacatgaggtgaagccagcctatgccaccaggtac
gccatcactgtctggtattttgatgccaaggaacgggcagcagccagagacaagtatcag
ctagcatcgggacagaaaggtgttcaagtaccagtatcacagccaactacacctacctaa

KEGG   Mus musculus (mouse): 112407Help
Entry
112407            CDS       T01002                                 

Gene name
Egln3, 2610021G09Rik, AI505553, AI648162, Hif-p4h-3, Phd3, SM-20
Definition
(RefSeq) egl-9 family hypoxia-inducible factor 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112407 (Egln3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112407 (Egln3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112407 (Egln3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112407 (Egln3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Motif
Other DBs
NCBI-GeneID: 112407
NCBI-ProteinID: NP_082409
MGI: 1932288
Ensembl: ENSMUSG00000035105
Vega: OTTMUSG00000034921
UniProt: Q91UZ4 A0A0R4J0H9
LinkDB All DBs
Position
12; 12 C1
AA seq 239 aa AA seqDB search
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQ
LAGPCAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgggacacatcatgaggctggatctggagaagatcgccctggagtacatcgtg
ccctgtctgcacgaggtcggcttctgctacctggacaacttcctaggcgaggtggtgggc
gactgcgtgctggagcgagtcaagcagctgcactacaacggggccctgcgtgacggccag
ctggccgggccgtgcgccggcgtctccaagcggcacctgcgaggcgaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcaacttcctcctgtccctcatcgaccgg
ctggtcctgtactgcgggagccggctgggcaaatactatgtcaaggagcggtccaaggca
atggtggcttgctatccaggaaatgggacaggttatgttcgccatgtggacaaccccaat
ggtgatggccgctgtatcacctgtatctactacctgaataagaattgggacgccaagtta
cacggaggggtcctgcggatatttccggaagggaaatcgtttgtagcagacgtggagccc
atttttgacagacttctgttcttctggtcagaccgcaggaatccacatgaagtccagccc
tcctatgccaccaggtacgctatgactgtctggtacttcgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactagaaaaactgaatctgctcttgctaaagactga

DBGET integrated database retrieval system