KEGG   Mus musculus (mouse): 113868Help
Entry
113868            CDS       T01002                                 

Gene name
Acaa1a, Acaa, Acaa1, D9Ertd25e, PTL
Definition
(RefSeq) acetyl-Coenzyme A acyltransferase 1A
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00592  alpha-Linolenic acid metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
Module
mmu_M00087  beta-Oxidation
mmu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113868 (Acaa1a)
   00592 alpha-Linolenic acid metabolism
    113868 (Acaa1a)
   01040 Biosynthesis of unsaturated fatty acids
    113868 (Acaa1a)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113868 (Acaa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113868 (Acaa1a)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    113868 (Acaa1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     113868 (Acaa1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 113868
NCBI-ProteinID: NP_570934
MGI: 2148491
Ensembl: ENSMUSG00000036138
Vega: OTTMUSG00000042191
UniProt: Q921H8
LinkDB All DBs
Position
9 F3; 9 71.33 cM
AA seq 424 aa AA seqDB search
MHRLQVVLGHLAGRPESSSALQAAPCSARFPQASASDVVVVHGRRTPIGRASRGGFKNTT
PDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGAGAVMARIAQFLSGIPETVPLSTVN
RQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNISSRLLESEKARDCLTP
MGMTSENVAERFGISRQKQDDFALASQQKAASAQSRGCFRAEIVPVTTTVLDDKGDKKTI
TVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPI
LGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLG
IPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFE
YPGN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggctgcaggtagtgctgggccacctggccggccggcccgagtcgagctccgcg
ctgcaagctgcgccctgctccgctaggttcccgcaggcctcggcctccgacgtggtggtg
gtgcacggacggcgcacccccatcggccgcgccagccgtggaggcttcaagaacaccacc
cccgacgagcttctgtcggccgtgttgaccgcggttctccaggacgtgaggctaaagcct
gagcagctgggagacatctccgtgggcaatgttcttgagccaggagccggggctgtcatg
gcacgcatcgcccaatttctgagcggcatcccagagactgtacctttgtctacggtcaac
agacagtgttcatcgggactgcaggcagtggccaacattgctggtggcatcagaaatggg
tcttatgacattggcatggcctgtggggtggagtccatgtccctgtctgggatggggaac
cctgggaatatctcttcccgcctgctggagagtgagaaagccagagactgcctgactcct
atggggatgacctcggagaatgtggctgagcggtttggcatttcacggcagaagcaggat
gactttgcgctggcctcccagcagaaggcagcaagcgcccagagcagaggatgcttccgt
gctgagattgtgcctgtgacaaccactgtcctggatgacaagggtgacaagaaaaccatc
accgtgtctcaggatgagggtgtccgtcccagcaccaccatgcagggcctggccaagctg
aagcctgccttcaaggatggaggctctaccacggctggaaactccagtcaggtgagtgat
ggagcagctgccgtcctgctggctcggaggtccaaggctgaagaactgggcctccccatc
cttggggtcctgaggtcctatgcagtggtcggggtccctcctgacgtcatgggcatcgga
cctgcctatgccatccctgcagccttgcagaaagcagggctgactgtgaatgacatagac
atctttgagatcaatgaggcctttgcaagtcaggccgtctactgtgtggagaagctagga
attcctgcagagaaggtgaacccgctggggggtgcaatagccctgggccaccccctgggc
tgcacgggagcaaggcaggttgtcacgctactcaatgaactgaagcgtcgtggcagacgg
gcttacggcgtggtgtccatgtgcatcgggactgggatgggagctgctgcggtctttgaa
taccctgggaactga

DBGET integrated database retrieval system