KEGG   Mus musculus (mouse): 11421Help
Entry
11421             CDS       T01002                                 

Gene name
Ace, AW208573, CD143
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu05142  Chagas disease (American trypanosomiasis)
mmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11421 (Ace)
   04614 Renin-angiotensin system
    11421 (Ace)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    11421 (Ace)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    11421 (Ace)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    11421 (Ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11421 (Ace)
   04090 CD Molecules [BR:mmu04090]
    11421 (Ace)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     11421 (Ace)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M2
   11421 (Ace)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11421 (Ace)
CD molecules [BR:mmu04090]
 Proteins
  11421 (Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF713 HupF_HypC
Motif
Other DBs
NCBI-GeneID: 11421
NCBI-ProteinID: NP_997507
MGI: 87874
Ensembl: ENSMUSG00000020681
Vega: OTTMUSG00000003113
UniProt: P09470 Q3TU20
LinkDB All DBs
Position
11 E1; 11 68.84 cM
AA seq 1312 aa AA seqDB search
MGAASGQRGRWPLSPPLLMLSLLVLLLQPSPAPALDPGLQPGNFSPDEAGAQLFAESYNS
SAEVVMFQSTVASWAHDTNITEENARRQEEAALVSQEFAEVWGKKAKELYESIWQNFTDS
KLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTNI
LASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQDDFSDTGAFWRSWYESPS
FEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGPIPAHLLGDMWAQSWENIYD
MVVPFPDKPNLDVTSTMVQKGWNATHMFRVSEEFFTSLGLSPMPPEFWAESMLEKPTDGR
EVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGHVQYYLQYKDLHVSLRRGANPG
FHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINYLLKMALEKIAFLPFGYLVDQWR
WGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHIPNVTPYIRYFVSFV
LQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQVLQAGCSRPWQEVLKDLVGSDALD
AKALLEYFQPVSQWLEEQNQRNGEVLGWPENQWRPPLPDNYPEGIDLETDEAKADRFVEE
YDRTAQVLLNEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNS
SIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPLEPDLTNMMA
TSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSLYESDNLE
QDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLV
APFPSAPNIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREV
VCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFH
EAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWR
VFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQ
FQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSAS
AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTARAEGSTAESNRVNFLGLYLEPQQA
RVGQWVLLFLGVALLVATVGLAHRLYNIRNHHSLRRPHRGPQFGSEVELRHS
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtccggccagcgggggcggtggccgttgtcgcctccgctcttgatgctg
tcgctgctggtgctgttgctgcagccgtcgcccgccccggcactcgaccctggattgcag
ccgggcaacttttccccggacgaggcaggggcgcagcttttcgctgaaagctataactcg
agtgccgaggtggtgatgttccagagcaccgtggccagttgggcgcacgacaccaacatc
acggaggagaacgcgcgacgccaggaggaagcggccctggtcagccaggagtttgcagag
gtctggggcaagaaggccaaggagttgtatgagtccatttggcagaactttactgactca
aagctgcgaaggatcatcggatctattcggaccctaggacctgccaatctgcccctggcc
cagcggcagcagtacaactctctgctaagcaacatgagcagaatctactccactggcaag
gtctgcttccccaacaagactgccacctgctggtccctggacccagagctcaccaacatc
ctggcttcctcacgaagctatgccaagttgttgtttgcctgggagggctggcatgatgct
gtgggtatcccactgaaacccctctatcaagactttactgccatcagtaacgaagcctac
agacaagacgacttctcagacacaggagccttctggcgctcctggtatgagtccccctcc
tttgaggagagtctggaacatatctaccaccaactagagcccctctacctgaacctccat
gcctacgtccgccgcgcactgcaccgccgctatggggacaaatacgtcaatctcaggggg
cctattcctgcccatttgctgggagacatgtgggcccagagctgggagaacatctacgac
atggtagtgcctttcccagacaaacccaacctcgatgtcaccagtacaatggtacagaag
ggctggaacgccacacacatgttccgggtatcagaggaattcttcacctcgctggggctc
tcacccatgcctcctgagttctgggcggagtcaatgctggagaaaccaacggatggacgg
gaggtggtgtgccacgcctctgcctgggacttctacaaccggaaggacttccggattaag
caatgcacacgggtcacgatggaacagctggccacagtacaccacgagatgggccacgtg
cagtactacctccagtacaaggacctgcacgtctctctgcgtagaggtgccaaccctggc
ttccatgaggccattggggatgtgcttgcactctccgtctctacccctgcacatctgcac
aaaatcggcctactggaccatgttaccaatgacatagagagtgacatcaattacctgcta
aagatggccctagagaaaatcgccttcttgccctttggctacctggtggaccagtggcgt
tggggggtcttcagtggacggaccccaccctctcgctacaacttcgactggtggtatctt
cgaaccaagtatcaggggatctgcccaccagttgcccggaatgaaacccattttgatgct
ggagccaagtttcacatcccaaacgtgacaccgtacatcaggtacttcgtgagctttgtg
ctgcagttccagttccatcaagcactgtgcaaggaggcaggccaccagggcccactacac
cagtgtgacatctaccagtccgcccaggcgggggccaagctcaagcaggtgttgcaggct
ggctgctccaggccctggcaggaggtactgaaggacctggtaggctcagatgccctggat
gccaaggcactgctggagtacttccaaccggtcagccagtggctggaagagcagaatcag
cggaatggcgaagtcctaggctggccagagaatcagtggcgtccaccgttacccgacaac
tatccagagggcattgacctagagactgatgaagccaaggctgacaggttcgtggaagag
tatgaccggacagcccaagtgttgttgaacgagtacgcagaggccaactggcaatataac
accaacattaccatagagggcagcaagatcctgcttgagaaaagcacggaggtatccaat
cacaccctgaaatatggcacccgggccaagacatttgatgtgagcaactttcaaaactct
tccatcaagcggatcataaagaagcttcagaacctggaccgggcagtgctgcctcccaag
gaattagaagagtacaaccagatcctgctagacatggagacaacttacagcttatccaac
atttgctacacaaatggcacttgtatgcccctggaacctgatctaacaaacatgatggcc
acatcccggaaatatgaagaattgctatgggcatggaagagctggagagacaaggtgggg
agagccatccttccttttttcccaaagtatgtggagttctccaacaagattgccaagctc
aatggctacacggatgcaggggattcatggagatccttatacgagtctgacaacctggag
caagacctggaaaaactgtaccaggagctgcagccactctacctgaacctgcatgcctat
gtgcgtcgttccctgcaccgccactatgggtccgagtacatcaacctggatggccccatt
cctgcccatctgctagggaacatgtgggcgcagacctggtccaacatctatgatttggtg
gcgcccttcccttccgcccccaatatagatgccacggaagccatgataaagcagggatgg
acacccagaaggatatttaaggaagctgacaatttctttacctccctggggctgttacct
gtgccccctgagttctggaacaagtcgatgttagagaagcccaccgatggaagggaggtg
gtgtgccatccctcagcctgggacttctacaacggcaaggacttcaggatcaagcagtgt
acctctgtgaacatggaggacttggtgatagcgcaccacgaaatgggccacatccagtat
ttcatgcagtacaaagacttacccgtgactttccgggagggtgccaaccctggttttcat
gaagctattggagatataatggctctctcagtgtctacccccaagcatctatacagtctc
aacctgcttagcactgagggcagtggctacgagtatgacatcaactttctaatgaagatg
gccctcgacaagatcgcctttatccccttcagctacctcatcgaccagtggcgctggagg
gtctttgatggaagcatcaccaaggagaactataaccaggagtggtggagcctcaggctg
aagtatcagggtctgtgccccccagtgccaagatcccaaggtgactttgacccagggtcc
aagttccacgttcctgcgaacgtgccatacgtcaggtactttgtcagcttcatcatccag
ttccagttccacgaggcgctgtgtcgcgcagccgggcacacgggtcccctgcacaagtgt
gacatctaccaatccaaggaagcagggaagctcctggcggatgccatgaagctgggctac
agtaagccgtggccagaggccatgaagctgatcacaggccagcctaacatgtcagcctcc
gccatgatgaattacttcaagccactgacagaatggctcgtcaccgagaacaggagacat
ggagagacactgggctggccggagtacaactgggcgccaaacaccgctcgcgcagaaggc
tccaccgcagagtccaaccgcgtcaatttcctgggcctgtacctggagccacagcaggcc
cgcgtgggccagtgggtgctgctcttcctgggcgtcgccctgctcgtggccaccgtgggt
ctcgcccatcggctctacaacatccgtaaccatcacagcctccgccggccccaccgtggg
ccccagtttgggtctgaggtggagctcagacactcctga

DBGET integrated database retrieval system