Mus musculus (house mouse): 11465 Help Entry 11465             CDS       T01002                                  Symbol Actg1, Actg, Actl, E51 Name (RefSeq) actin, gamma, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism mmu  Mus musculus (house mouse) Pathway mmu03082   ATP-dependent chromatin remodeling mmu04015   Rap1 signaling pathway mmu04145   Phagosome mmu04210   Apoptosis mmu04390   Hippo signaling pathway mmu04510   Focal adhesion mmu04520   Adherens junction mmu04530   Tight junction mmu04611   Platelet activation mmu04613   Neutrophil extracellular trap formation mmu04670   Leukocyte transendothelial migration mmu04714   Thermogenesis mmu04810   Regulation of actin cytoskeleton mmu04814   Motor proteins mmu04820   Cytoskeleton in muscle cells mmu04919   Thyroid hormone signaling pathway mmu04921   Oxytocin signaling pathway mmu04971   Gastric acid secretion mmu05014   Amyotrophic lateral sclerosis mmu05100   Bacterial invasion of epithelial cells mmu05132   Salmonella infection mmu05135   Yersinia infection mmu05164   Influenza A mmu05205   Proteoglycans in cancer mmu05225   Hepatocellular carcinoma mmu05410   Hypertrophic cardiomyopathy mmu05412   Arrhythmogenic right ventricular cardiomyopathy mmu05414   Dilated cardiomyopathy mmu05416   Viral myocarditis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     11465 (Actg1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     11465 (Actg1)    04390 Hippo signaling pathway     11465 (Actg1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     11465 (Actg1)   09143 Cell growth and death    04210 Apoptosis     11465 (Actg1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     11465 (Actg1)    04520 Adherens junction     11465 (Actg1)    04530 Tight junction     11465 (Actg1)   09142 Cell motility    04814 Motor proteins     11465 (Actg1)    04820 Cytoskeleton in muscle cells     11465 (Actg1)    04810 Regulation of actin cytoskeleton     11465 (Actg1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     11465 (Actg1)    04613 Neutrophil extracellular trap formation     11465 (Actg1)    04670 Leukocyte transendothelial migration     11465 (Actg1)   09152 Endocrine system    04921 Oxytocin signaling pathway     11465 (Actg1)    04919 Thyroid hormone signaling pathway     11465 (Actg1)   09154 Digestive system    04971 Gastric acid secretion     11465 (Actg1)   09159 Environmental adaptation    04714 Thermogenesis     11465 (Actg1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     11465 (Actg1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     11465 (Actg1)   09172 Infectious disease: viral    05164 Influenza A     11465 (Actg1)   09171 Infectious disease: bacterial    05132 Salmonella infection     11465 (Actg1)    05135 Yersinia infection     11465 (Actg1)    05100 Bacterial invasion of epithelial cells     11465 (Actg1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     11465 (Actg1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     11465 (Actg1)    05410 Hypertrophic cardiomyopathy     11465 (Actg1)    05412 Arrhythmogenic right ventricular cardiomyopathy     11465 (Actg1)    05414 Dilated cardiomyopathy     11465 (Actg1)    05416 Viral myocarditis     11465 (Actg1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mmu03021]     11465 (Actg1)    03019 Messenger RNA biogenesis [BR:mmu03019]     11465 (Actg1)    03036 Chromosome and associated proteins [BR:mmu03036]     11465 (Actg1)    03029 Mitochondrial biogenesis [BR:mmu03029]     11465 (Actg1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmu04812]     11465 (Actg1)    04147 Exosome [BR:mmu04147]     11465 (Actg1) Transcription machinery [BR:mmu03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      11465 (Actg1) Messenger RNA biogenesis [BR:mmu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      11465 (Actg1) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      11465 (Actg1)     NuA4 complex      11465 (Actg1)   Chromatin remodeling factors    BAF complex     11465 (Actg1)    PBAF complex     11465 (Actg1)    GBAF(ncBAF) complex     11465 (Actg1)    SWR1 complex     11465 (Actg1) Mitochondrial biogenesis [BR:mmu03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     11465 (Actg1) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      11465 (Actg1) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    11465 (Actg1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  11465 NCBI-ProteinID:  NP_033739 MGI:  87906 Ensembl:  ENSMUSG00000062825 UniProt:  P63260 Q4KL81 LinkDB All DBs Position 11:complement(120236513..120239321) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgcactcgtcattgacaatggctccggcatgtgcaaagccggc tttgctggcgacgacgcccccagggccgtgttcccttccatcgtagggcgcccccgacac cagggcgtcatggtgggcatgggccagaaagactcatacgtgggtgacgaggcccagagc aagaggggtatcctgaccctgaagtaccctatcgaacacggcattgtcactaactgggac gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag cacccggtgcttctgaccgaggcccccctgaaccccaaagctaacagagagaagatgacg cagataatgtttgaaaccttcaataccccagccatgtacgtggccattcaggcggtgctg tccttgtatgcatctgggcgcaccactggcattgtcatggactctggtgacggggtcaca cacacagtgcccatctatgagggctacgcccttccccacgccatcttgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgactgaacggggctacagcttt accaccactgctgagagggaaattgttcgtgacataaaggagaagctgtgctatgttgcc ctggattttgagcaagaaatggctactgctgcatcatcttcctccttggagaagagttac gagctgcccgacgggcaggtgatcaccattggcaatgagcggttccggtgtccggaggca ctcttccagccttccttcctgggcatggagtcctgtggtatccatgagaccactttcaac tccatcatgaagtgtgatgtggatatccgcaaagacctgtatgccaatacagtgctgtct ggtggtaccaccatgtacccaggcattgctgacaggatgcagaaggagatcacagcccta gcacctagcacgatgaagattaagatcattgctccccctgagcgcaagtactcagtctgg atcggtggctccattctggcctcactgtccaccttccagcagatgtggatcagcaagcag gagtatgatgagtcaggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system