KEGG   Mus musculus (mouse): 11477Help
Entry
11477             CDS       T01002                                 

Gene name
Acvr1, ALK2, ActR-I, ActRIA, Acvr, Acvr1a, Acvrlk2, Alk-2, Alk8, D330013D15Rik, SKR1, Tsk7L
Definition
(RefSeq) activin A receptor, type 1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11477 (Acvr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11477 (Acvr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11477 (Acvr1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11477 (Acvr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11477 (Acvr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11477 (Acvr1)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   11477 (Acvr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Haspin_kinase APH FTA2
Motif
Other DBs
NCBI-GeneID: 11477
NCBI-ProteinID: NP_001103674
MGI: 87911
Ensembl: ENSMUSG00000026836
Vega: OTTMUSG00000012677
UniProt: P37172
LinkDB All DBs
Position
2; 2 C1.1
AA seq 509 aa AA seqDB search
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
AELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatggagtaatgatccttcctgtgctaatgatgatggctttcccttccccgagt
gtggaagatgagaagcccaaggtcaaccagaaactttacatgtgtgtgtgtgagggcctc
tcctgcgggaacgaggaccactgtgaaggccagcagtgtttttcttctctgagcatcaac
gatggcttccacgtctaccagaagggctgctttcaggtttatgagcaggggaagatgacg
tgtaagaccccgccgtcacctggccaggctgtggagtgctgccaaggggactggtgtaac
aggaacatcacggcccagctgcccactaaagggaagtccttccccggaacacagaatttc
cacctggaagttggccttatcatcctctcggtggtgtttgcagtatgtcttttagcttgc
atccttggagttgctctcaggaagtttaagagacgcaatcaagagcgcctgaaccccaga
gacgtggagtatggtaccattgaagggctcatcaccaccaatgtgggagacagcactcta
gcggaactactagatcactcgtgtacatcaggaagtggctccggtcttcctttcctggta
cagagaacggtggctcgccagataaccctgttggagtgtgtcgggaagggccggtatgga
gaagtatggaggggcagctggcaaggcgaaaatgtcgctgtgaagatcttctcctcccga
gacgagaagtcatggttcagggagacggaattgtacaacactgtgatgttgaggcatgaa
aatatcttaggtttcatcgcttcagacatgacctccagacactccagtacccagctgtgg
ctcatcacacattaccatgaaatgggatcgttgtatgactaccttcagctcactactctg
gatacggttagctgccttcggattgtactgtccatagccagcggccttgcccatttgcac
atagagatatttgggacccaagggaagtccgccattgcccatcgagatctgaagagcaaa
aacatcctggtgaagaagaatggacagtgctgcatagcagatttgggcctggcagtcatg
cattcccagagcacaaaccagcttgatgtgggaaacaacccccgtgtggggaccaagcgc
tacatggctccggaagtgctcgatgaaaccatccaagtggattgctttgattcttataag
agggtcgatatttgggcctttggccttgttctgtgggaagtggccaggcgaatggtgagc
aatggtatagtggaagattacaagccaccattctatgatgtggttcccaatgacccaagt
tttgaagatatgaggaaagttgtctgtgtggatcaacagaggccaaacatacctaacaga
tggttctcagacccgacattaacttctctggcgaagctgatgaaagagtgctggtatcag
aacccatccgcaagactcacagctctacgtatcaaaaagactttgaccaaaatcgataat
tccctagacaaattaaaaactgactgttga

KEGG   Mus musculus (mouse): 12166Help
Entry
12166             CDS       T01002                                 

Gene name
Bmpr1a, 1110037I22Rik, ALK-3, ALK3, AU045487, BMPR-1A, BMPR-IA, Bmpr, SKR5
Definition
(RefSeq) bone morphogenetic protein receptor, type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12166 (Bmpr1a)
   04390 Hippo signaling pathway
    12166 (Bmpr1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12166 (Bmpr1a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12166 (Bmpr1a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12166 (Bmpr1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12166 (Bmpr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12166 (Bmpr1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12166 (Bmpr1a)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   12166 (Bmpr1a)
CD molecules [BR:mmu04090]
 Proteins
  12166 (Bmpr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 12166
NCBI-ProteinID: NP_033888
MGI: 1338938
Ensembl: ENSMUSG00000021796
Vega: OTTMUSG00000036087
UniProt: P36895 Q53Z43
LinkDB All DBs
Position
14 B; 14 20.81 cM
AA seq 532 aa AA seqDB search
MTQLYTYIRLLGACLFIISHVQGQNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVVLISMAVCIVAMIIFSSCFCYKHYC
KSISSRGRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDIPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctatacacttacatcagattactgggagcctgtctgttcatcatttctcat
gttcaagggcagaatctagatagtatgctccatggcactggtatgaaatcagacttggac
cagaagaagccagaaaatggagtgactttagcaccagaggataccttgcctttcttaaag
tgctattgctcaggacactgcccagatgatgctattaataacacatgcataactaatggc
cattgctttgccattatagaagaagatgatcagggagaaaccacattaacttctgggtgt
atgaagtatgaaggctctgattttcaatgcaaggattcaccgaaagcccagctacgcagg
acaatagaatgttgtcggaccaatttgtgcaaccagtatttgcagcctacactgccccct
gttgttataggtccgttctttgatggcagcatccgatggctggttgtgctcatttccatg
gctgtctgtatagttgctatgatcatcttctccagctgcttttgctataagcattattgt
aagagtatctcaagcaggggtcgttacaaccgtgatttggaacaggatgaagcatttatt
ccagtaggagaatcattgaaagacctgattgaccagtcccaaagctctgggagtggatct
ggattgcctttattggttcagcgaactattgccaaacagattcagatggttcggcaggtt
ggtaaaggccgctatggagaagtatggatgggtaaatggcgtggtgaaaaagtggctgtc
aaagtgttttttaccactgaagaagctagctggtttagagaaacagaaatctaccagacg
gtgttaatgcgtcatgaaaatatacttggttttatagctgcagacattaaaggcactggt
tcctggactcagctgtatttgattactgattaccatgaaaatggatctctctatgacttc
ctgaaatgtgccacactagacaccagagccctactcaagttagcttattctgctgcttgt
ggtctgtgccacctccacacagaaatttatggtacccaagggaagcctgcaattgctcat
cgagacctgaagagcaaaaacatccttattaagaaaaatggaagttgctgtattgctgac
ctgggcctagctgttaaattcaacagtgatacaaatgaagttgacatacccttgaatacc
agggtgggcaccaagcggtacatggctccagaagtgctggatgaaagcctgaataaaaac
catttccagccctacatcatggctgacatctatagctttggtttgatcatttgggaaatg
gctcgtcgttgtattacaggaggaatcgtggaggaatatcaattaccatattacaacatg
gtgcccagtgacccatcctatgaggacatgcgtgaggttgtgtgtgtgaaacgcttgcgg
ccaatcgtgtctaaccgctggaacagcgatgaatgtcttcgagcagttttgaagctaatg
tcagaatgttgggcccataatccagcctccagactcacagctttgagaatcaagaagaca
cttgcaaaaatggttgaatcccaggatgtaaagatttga

KEGG   Mus musculus (mouse): 12167Help
Entry
12167             CDS       T01002                                 

Gene name
Bmpr1b, AI385617, ALK-6, AV355320, Acvrlk6, Alk6, BMPR-1B, BMPR-IB, CFK-43a, SKR6
Definition
(RefSeq) bone morphogenetic protein receptor, type 1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12167 (Bmpr1b)
   04390 Hippo signaling pathway
    12167 (Bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12167 (Bmpr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12167 (Bmpr1b)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    12167 (Bmpr1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12167 (Bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12167 (Bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12167 (Bmpr1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12167 (Bmpr1b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   12167 (Bmpr1b)
CD molecules [BR:mmu04090]
 Proteins
  12167 (Bmpr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 12167
NCBI-ProteinID: NP_001264145
MGI: 107191
Ensembl: ENSMUSG00000052430
Vega: OTTMUSG00000025350
UniProt: P36898 B2RRZ4
LinkDB All DBs
Structure
PDB: 

Position
3; 3 H1
AA seq 502 aa AA seqDB search
MLLRSSGKLNVGTKKEDGESTAPTPRPKILRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKDRDFVD
GPIHHKALLISVTVCSLLLVLIILFCYFRYKRQEARPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEIARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCMKKLRPSFPNRWSSDECLRQMGKLMTECWAQNPAS
RLTALRVKKTLAKMSESQDIKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcttacgaagctctggaaaattaaatgtgggcaccaagaaggaggatggagagagt
acagcccccacccctcggcccaagatcctacgttgtaaatgccaccaccactgtccggaa
gactcagtcaacaatatctgcagcacagatgggtactgcttcacgatgatagaagaagat
gactctggaatgcctgttgtcacctctggatgtctaggactagaagggtcagattttcaa
tgtcgtgacactcccattcctcatcaaagaagatcaattgaatgctgcacagaaaggaat
gagtgtaataaagacctccaccccactctgcctcctctcaaggacagagattttgttgat
gggcccatacaccacaaggccttgcttatctctgtgactgtctgtagtttactcttggtc
ctcattattttattctgttacttcaggtataaaagacaagaagcccgacctcggtacagc
attgggctggagcaggacgagacatacattcctcctggagagtccctgagagacttgatc
gagcagtctcagagctcgggaagtggatcaggcctccctctgctggtccaaaggacaata
gctaagcaaattcagatggtgaagcagattggaaaaggccgctatggcgaggtgtggatg
ggaaagtggcgtggagaaaaggtggctgtgaaagtgttcttcaccacggaggaagccagc
tggttccgagagactgagatatatcagacggtcctgatgcggcatgagaatattctgggg
ttcattgctgcagatatcaaagggactgggtcctggactcagttgtacctcatcacagac
tatcatgaaaacggctccctttatgactatctgaaatccaccaccttagacgcaaagtcc
atgctgaagctagcctactcctctgtcagcggcctatgccatttacacacggaaatcttt
agcactcaaggcaagccagcaatcgcccatcgagacttgaaaagtaaaaacatcctggtg
aagaaaaatggaacttgctgcatagcagacctgggcttggctgtcaagttcattagtgac
acaaatgaggttgacatcccacccaacacccgggttggcaccaagcgctatatgcctcca
gaagtgctggacgagagcttgaatagaaaccatttccagtcctacattatggctgacatg
tacagctttggactcatcctctgggagattgcaaggagatgtgtttctggaggtatagtg
gaagaataccagcttccctatcacgacctggtgcccagtgacccttcttatgaggacatg
agagaaattgtgtgcatgaagaagttacggccttcattccccaatcgatggagcagtgat
gagtgtctcaggcagatggggaagcttatgacagagtgctgggcgcagaatcctgcctcc
aggctgacggccctgagagttaagaaaacccttgccaaaatgtcagagtcccaggacatt
aaactctga

KEGG   Mus musculus (mouse): 12168Help
Entry
12168             CDS       T01002                                 

Gene name
Bmpr2, 2610024H22Rik, AL117858, AW546137, BB189135, BMP-2, BMPR-2, BMPR-II, BMPRII, BRK-3, Gm20272
Definition
(RefSeq) bone morphogenetic protein receptor, type II (serine/threonine kinase)
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05206  MicroRNAs in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12168 (Bmpr2)
   04390 Hippo signaling pathway
    12168 (Bmpr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12168 (Bmpr2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12168 (Bmpr2)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    12168 (Bmpr2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12168 (Bmpr2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12168 (Bmpr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12168 (Bmpr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12168 (Bmpr2)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   12168 (Bmpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Cadherin_C_2 FTA2
Motif
Other DBs
NCBI-GeneID: 12168
NCBI-ProteinID: NP_031587
MGI: 1095407
Ensembl: ENSMUSG00000067336
Vega: OTTMUSG00000047258
UniProt: O35607 Q3UU71 Q3UG09 Q3UER5
LinkDB All DBs
Position
1; 1 C2
AA seq 1038 aa AA seqDB search
MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGACVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRC
TDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGAVPAGQAANIVA
HRSQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDILTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQIGEST
QDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLA
EGGTATTTVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcatcggccctttcgggtgccctggctgctatgggccgtcctgctg
gtcagcactacggctgcttctcagaatcaagaacggctgtgtgcatttaaagatccatat
caacaagatcttgggataggtgagagtcgaatctctcatgaaaatgggacaatattatgt
tccaaagggagcacgtgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaaggatgttggtctcacatcggtgatccccaagagtgccactatgaagagtgtgta
gtaactaccaccccaccctcaattcagaatggaacgtaccgcttttgctgctgtagtaca
gatttatgtaatgtcaactttactgagaactttccaccccctgacacaacaccactcagt
ccacctcattcatttaatcgagatgaaacgataatcattgctttggcatcagtttctgtg
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacaggagaccggaaa
cagggtcttcacagcatgaacatgatggaggcggcagcagcagagccctcccttgacctg
gataacctgaagctgctggagctgattggacggggtcgatacggagcagtatataaaggt
tccttggatgagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaatttt
ataaatgaaaaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttc
atagttggagacgagaggctcactgcagacggccgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaaatatctgagtctccacacaagtgattgggtaagc
tcttgccgtctggctcattctgtgactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacccgcaatctcccaccgagatttaaacagcaggaatgtcctg
gtaaagaatgacggcgcgtgtgttatcagtgactttggtttatccatgaggctaactgga
aatcggctggtgcgcccaggggaagaagataatgcggctataagtgaggttggcacaatt
cgctatatggcaccagaagtgctagaaggagctgtgaacctgagggactgtgagtcagct
ctgaagcaagtggacatgtatgcgcttggactcatctactgggaggtgtttatgaggtgt
acagacctcttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagtt
ggaaaccatcccacatttgaggatatgcaggttcttgtgtccagagagaagcagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggaaacaatt
gaagactgctgggaccaggatgcagaggctcggctcactgcacagtgtgctgaggagagg
atggctgaactcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaaccca
atgtcaactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatc
gggccttacccagattattcctcttcctcatatattgaagactctatccatcatactgac
agcattgtgaagaatatttcctctgagcattcgatgtccagcacaccattgacaatagga
gaaaagaatcgaaattcaattaattatgaacgacagcaagcacaagctcgaatccctagc
ccagaaacaagcgtcacaagcctgtccacaaacacaaccaccacaaacaccaccggcctc
actccaagtactggcatgaccactatatctgagatgccatacccagatgagacacatttg
cacgccacaaatgttgcacagtcaatcgggccaacccctgtctgcttacagctgacagaa
gaagacttggagactaataagctagatccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcattctctgaagcagttcagtgggccagacccattgagc
agtaccagttctagcttgctttatccactcataaagctcgcagtggaagtgactggacaa
caggacttcacacaggctgcaaatgggcaagcatgtttaattcctgatgttccacctgct
cagatctatcctctccctaagcaacagaaccttcctaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagaaccccggctaaaatttggcaacaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcat
gtggtgacagtaactatgaatggtgtggcaggtagaagccacaatgttaattcccatgct
gccacaacccagtatgccaatggcgcagtgccagctggccaggcagccaacatagtggca
cataggtcccaagaaatgctgcagaatcaatttattggtgaggataccaggctgaatatc
aattccagtcctgatgagcatgaacctttactgagacgagagcaacaggctggccatgat
gaaggggttctggatcgtttggtagataggagggaacggccattagaaggtggccgaaca
aattccaataacaacaacagcaatccatgttcagaacaagatatccttacacaaggtgtt
acaagcacagctgcagatcctgggccatcaaagcccagaagagcacagaggcccaattct
ctggatctttcagccacaaatatcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagagacgtgtgaaaactccatactct
cttaagcggtggcgcccgtccacctgggtcatctccaccgagccgctggactgtgaggtc
aacaacaatggcagtgacagggcagtccattctaaatctagcactgctgtgtaccttgca
gagggaggcactgccacgaccacagtgtctaaagatataggaatgaattgtctgtga

DBGET integrated database retrieval system