KEGG   Mus musculus (mouse): 11479Help
Entry
11479             CDS       T01002                                 

Gene name
Acvr1b, 6820432J04, ALK-4, ActR-IB, ActRIB, Acvrlk4, Alk4, SKR2
Definition
(RefSeq) activin A receptor, type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11479 (Acvr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11479 (Acvr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11479 (Acvr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11479 (Acvr1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11479 (Acvr1b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   11479 (Acvr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Motif
Other DBs
NCBI-GeneID: 11479
NCBI-ProteinID: NP_031421
MGI: 1338944
Ensembl: ENSMUSG00000000532
Vega: OTTMUSG00000048171
UniProt: Q61271 Q3TZF1
LinkDB All DBs
Position
15 F1; 15 56.48 cM
AA seq 505 aa AA seqDB search
MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLD
GVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEDYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccgggggatccaggctctgctgtgtgcgtgcaccagctgccta
cagaccaactacacctgtgagacagatggggcttgcatggtctccatctttaacctggat
ggcgtggagcaccatgtacgtacctgcatccccaaggtggagctggttcctgctggaaag
cccttctactgcctgagttcagaggatctgcgcaacacacactgctgctatattgacttc
tgcaacaagattgacctcagggtccccagcggacacctcaaggagcctgcgcacccctcc
atgtggggccctgtggagctggtcggcatcatcgccggccccgtcttcctcctcttcctt
atcattatcatcgtcttcctggtcatcaactatcaccagcgtgtctaccataaccgccag
aggttggacatggaggacccctcttgcgagatgtgtctctccaaagacaagacgctccag
gatctcgtctacgacctctccacgtcagggtctggctcagggttacccctttttgtccag
cgcacagtggcccgaaccattgttttacaagagattatcggcaagggccggttcggggaa
gtatggcgtggtcgctggaggggtggtgacgtggctgtgaaaatcttctcttctcgtgaa
gaacggtcttggttccgtgaagcagagatctaccagaccgtcatgctgcgccatgaaaac
atccttggctttattgctgctgacaataaagataatggcacctggacccagctgtggctt
gtctctgactatcacgagcatggctcactgtttgattatctgaaccgctacacagtgacc
attgagggaatgattaagctagccttgtctgcagccagtggtttggcacacctgcatatg
gagattgtgggcactcaagggaagccgggaattgctcatcgagacttgaagtcaaagaac
atcctggtgaaaaaaaatggcatgtgtgccattgcagacctgggcctggctgtccgtcat
gatgcggtcactgacaccatagacattgctccaaatcagagggtggggaccaaacgatac
atggctcctgaagtccttgacgagacaatcaacatgaagcactttgactccttcaaatgt
gccgacatctatgccctcgggcttgtctactgggagattgcacgaagatgcaattctgga
ggagtccatgaagactatcaactgccgtattacgacttagtgccctccgacccttccatt
gaggagatgcgaaaggttgtatgtgaccagaagctacggcccaatgtccccaactggtgg
cagagttatgaggccttgcgagtgatgggaaagatgatgcgggagtgctggtacgccaat
ggtgctgcccgtctgacagctctgcgcatcaagaagactctgtcccagctaagcgtgcag
gaagatgtgaagatttaa

KEGG   Mus musculus (mouse): 11480Help
Entry
11480             CDS       T01002                                 

Gene name
Acvr2a, ActrIIa, Acvr2, TactrII
Definition
(RefSeq) activin receptor IIA
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11480 (Acvr2a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11480 (Acvr2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11480 (Acvr2a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11480 (Acvr2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11480 (Acvr2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11480 (Acvr2a)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   11480 (Acvr2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 11480
NCBI-ProteinID: NP_031422
MGI: 102806
Ensembl: ENSMUSG00000052155
Vega: OTTMUSG00000012394
UniProt: P27038 A2AI38 Q8BRV4
LinkDB All DBs
Structure
PDB: 

Position
2 C1.1; 2 28.38 cM
AA seq 513 aa AA seqDB search
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgttcgccgtctttcttatctcttgctcttcaggtgct
atacttggcagatcagaaactcaggagtgtcttttctttaatgctaattgggaaagagac
agaaccaaccagactggtgttgaaccttgctatggtgataaagataaacggcgacattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaagcaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtatagaaaaaaaagacagccctgaagtg
tacttttgttgctgtgagggcaatatgtgtaatgaaaagttctcttattttccggagatg
gaagtcacacagcccacttcaaatcctgttacaccgaagccaccctattacaacattctg
ctgtattccttggtaccactaatgttaattgcaggaattgtcatttgtgcattttgggtg
tacagacatcacaagatggcctaccctcctgtacttgttcctactcaagacccaggacca
cccccaccttccccattactagggttgaagccattgcagctgttagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgctcaatgaatatgtggctgtcaaaata
tttccaatacaggacaaacagtcctggcagaatgaatatgaagtctatagtctacctgga
atgaagcatgagaacatactacagttcattggtgcagagaaaagaggcaccagtgtggat
gtggacctgtggctaatcacagcatttcatgaaaagggctcactgtcagactttcttaag
gctaatgtggtctcttggaatgaactttgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcttaaaagatggccacaagcctgcaatctctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaatctgacagcttgcattgctgac
tttgggttggccttaaagttcgaggctggcaagtctgcaggtgacacccatgggcaggtt
ggtacccggaggtatatggctccagaggtgttggagggtgctataaacttccaaagggac
gcatttctgaggatagatatgtacgccatgggattagtcctatgggaattggcttctcgt
tgcactgctgcagatggacccgtagatgagtacatgttaccatttgaggaagaaattggc
cagcatccatctcttgaagatatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgcaggaatggcaatgctctgtgaaacgatagaagaa
tgttgggatcatgatgcagaagccaggttatcagctggatgtgtaggtgaaagaattact
cagatgcaaagactaacaaatatcattactacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

KEGG   Mus musculus (mouse): 11481Help
Entry
11481             CDS       T01002                                 

Gene name
Acvr2b, 4930516B21Rik, AI047905, ActRIIB
Definition
(RefSeq) activin receptor IIB
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    11481 (Acvr2b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11481 (Acvr2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11481 (Acvr2b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11481 (Acvr2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11481 (Acvr2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     11481 (Acvr2b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   11481 (Acvr2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 11481
NCBI-ProteinID: NP_031423
MGI: 87912
Ensembl: ENSMUSG00000061393
Vega: OTTMUSG00000062989
UniProt: P27040
LinkDB All DBs
Structure
PDB: 

Position
9; 9 F3
AA seq 536 aa AA seqDB search
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEVRQCQR
WAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAV
KIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDY
LKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
LADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWEL
VSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVT
IEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgccctgggcggccctcgcccttctctggggatcgctgtgcgccggttccggg
cgaggggaggctgagactcgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgagggggaacaggacaagcggctgcactgctac
gcctcgtggcgcaacagctcgggcaccatcgagctggtgaagaagggctgctggctagat
gacttcaattgctacgacaggcaggagtgtgtggccaccgaggagaacccccaggtgtac
ttctgctgctgcgaaggcaacttctgcaacgagcgcttcacccacttgccggagcctggg
ggcccagaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcgctgctgcccattggaggcctctctctcatcgtcctgctggccttctggatgtat
cgtcatcggaagcctccctacggccatgtggacatccatgaggtgagacagtgccagcgt
tgggcagggagaagggacggctgtgcggactcctttaagcccttgcctttccaggacccg
gggcctccgcccccatcccctctggtgggcctgaagccactacagctgctggagatcaag
gctcggggccgctttggctgcgtttggaaagctcagctcatgaacgactttgtggctgtg
aagatcttcccacttcaggacaagcagtcgtggcagagtgaacgggaaatcttcagcaca
cccggcatgaagcacgaaaacttgttgcagttcattgctgccgagaaacgaggctccaac
ctggaggtggagctgtggctcatcacagccttccacgacaagggctccctcacggattac
ctcaaggggaacatcatcacgtggaacgaactgtgccacgtggcggagacgatgtcacga
ggcctctcatacctgcatgaggatgtgccgtggtgtcgtggtgagggccacaagccttct
attgcccacagggacttcaaaagcaagaatgtactgctgaagagcgacctcaccgcggtg
ctggctgacttcggcctggctgttcggtttgagccagggaagcctcctggggatacccat
ggacaggttggcaccagacggtacatggcccctgaggtgctggaaggagccatcaacttc
cagagagacgccttcctgcgtatcgacatgtacgccatgggcctggtgctgtgggagctc
gtctctcggtgcaaggctgcagacgggcctgtcgatgagtacatgctgcccttcgaggag
gagattggccagcacccttcgctggaggagcttcaggaggtggttgtccacaagaagatg
aggcccacgattaaggatcactggctgaaacacccgggcctggcccagctctgcgtgacc
atcgaggagtgctgggaccatgatgcagaggctcgcctttctgcaggctgtgtagaagag
cgggtatccctgatcaggaggtcggtcaacggcactacctcggactgtctcgtctctctg
gtgacctccgtcaccaatgtggacctgctccctaaagagtccagcatctaa

KEGG   Mus musculus (mouse): 269275Help
Entry
269275            CDS       T01002                                 

Gene name
Acvr1c, ACTR-IC, ACVRLK7, ALK7, Alk-7, C230097P10
Definition
(RefSeq) activin A receptor, type IC
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    269275 (Acvr1c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    269275 (Acvr1c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    269275 (Acvr1c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    269275 (Acvr1c)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     269275 (Acvr1c)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   269275 (Acvr1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 269275
NCBI-ProteinID: NP_001104500
MGI: 2661081
Ensembl: ENSMUSG00000026834
Vega: OTTMUSG00000012673
UniProt: Q8K348
LinkDB All DBs
Position
2; 2 C1.1
AA seq 493 aa AA seqDB search
MTPARGSALSLALLLVALAADLAAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPRLGPTELTVVITV
PVCLLSIAAMLTIWACQDRQCTYRKTKRHNVEEALAEYSLVNAGKTLKDLIYDATASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMVKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCDTCAIADLGLAVKHDSIMNTIDIPQN
PKVGTKRYMAPEMLDDTMNLSIFESFKRADIYSVGLVYWEIARRCSVGGVVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKLRPNLPNQWQSCEALRVMGRIMRECWYANGAARLTALRVKK
TISQLCVKEDCKA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagcgcgcggctccgcactgagcctggccctcctgctggtggccctggccgcc
gaccttgcggcaggactgaagtgtgtgtgtcttttgtgtgattcttcaaacttcacctgc
caaacggaaggagcatgttgggcctccgtcatgctaaccaacgggaaagagcaggtgatc
aaatcgtgtgtgtccctcccggaactaaatgctcaggtcttctgtcacagttccaacaac
gtgaccaaaaccgaatgttgcttcacagacttctgcaacaatatcacactgcaccttccc
acagcatcgccaaatgcccctcgacttggtcccacagagctgacggttgttatcaccgtg
ccggtttgcctcctgtccatagccgccatgctaacaatatgggcgtgccaggaccgccag
tgcacatacaggaagactaagagacacaacgtggaggaagcgctggctgagtacagcctt
gtgaatgcaggaaaaacactcaaggatctgatctacgatgctactgcctctggctcaggc
tctggtctgcctctcttggttcaaagaacaatcgcaaggacaattgtacttcaagaaatc
gtaggaaaaggtcggtttggggaagtgtggcacggaagatggtgtggagaagatgtggct
gtgaaaatattctcctccagggatgagagatcttggttccgtgaggcggaaatttatcag
acggtgatgctgagacacgagaacatcctcggtttcatcgcagctgacaacaaagataat
ggaacttggacacaactctggcttgtgtcagagtatcacgagcagggctccttgtatgac
tatttgaacagaaacatagtgactgtggctggaatggtcaagctggcgctttccatagcg
agtggtctggctcacctgcacatggagatcgtgggtactcaaggtaagcctgctattgct
caccgagatataaagtcaaagaatatcctagtcaaaaaatgtgacacttgtgccatagct
gacttagggctggctgtgaagcacgattctatcatgaacactatagacataccccagaat
cctaaagtgggaaccaagaggtacatggctcccgaaatgcttgatgatacaatgaacctg
agcatctttgagtccttcaagcgagctgacatctattcggtggggctggtttactgggaa
atagctcgaaggtgttcagttggaggagttgttgaggagtaccagttgccttactatgac
atggtgccttcagatccttcgatagaagaaatgaggaaggttgtctgtgatcagaaactc
cgaccaaatctcccaaaccagtggcaaagctgtgaagcgctgcgggtcatgggaagaata
atgcgtgagtgctggtacgccaacggggcagcacgcctgacagccctgcgcgtgaagaag
accatctcccagctgtgtgtcaaggaagactgtaaagcttag

DBGET integrated database retrieval system