KEGG   Mus musculus (mouse): 11545Help
Entry
11545             CDS       T01002                                 

Gene name
Parp1, 5830444G22Rik, AI893648, ARTD1, Adprp, Adprt1, C80510, PARP, PPOL, msPARP, parp-1, sPARP-1
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    11545 (Parp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11545 (Parp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11545 (Parp1)
   04217 Necroptosis
    11545 (Parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11545 (Parp1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11545 (Parp1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11545 (Parp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     11545 (Parp1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     11545 (Parp1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11545 (Parp1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     11545 (Parp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT
Motif
Other DBs
NCBI-GeneID: 11545
NCBI-ProteinID: NP_031441
MGI: 1340806
Ensembl: ENSMUSG00000026496
Vega: OTTMUSG00000050450
UniProt: Q921K2
LinkDB All DBs
Position
1 H4; 1 84.44 cM
AA seq 1014 aa AA seqDB search
MAEASERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRQPDVEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKS
NRSMCKGCLEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQ
LKGFSLLSAEDKEALKKQLPAIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALK
AQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
GQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPKEFREISYLKKLKVKKQDRIFPP
ESSAPAPLALPLSVTSAPTAVNSSAPADKPLSNMKILTLGKLSQNKDEAKAVIEKLGGKL
TGSANKASLCISTKKEVEKMSKKMEEVKAANVRVVCEDFLQDVSASTKSLQELLSAHSLS
SWGAEVKAEPGEVVAPKGKSAAPSKKSKGAVKEEGVNKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVKPG
TKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAV
SQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIE
REGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
SITLEGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcctcggagaggctttatcgagtggagtacgcgaagagcgggcgcgcctct
tgcaagaaatgcagcgagagtattcccaaggactccctccgcatggccatcatggtgcag
tcacccatgttcgatgggaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcagcctgatgttgaggtggatggcttctctgagctgcgctgggat
gatcagcagaaggtcaagaagacggccgaggctggaggcgtggcaggcaaaggccaggat
ggaagtggcggcaaggcggagaagacattgggtgactttttagcggagtacgccaagtcc
aacaggagcatgtgcaagggctgcctggagaagatagagaagggccagatgcgcctgtcc
aagaagatggtggatccagagaagccacagctgggtatgattgaccgctggtaccatcca
acttgctttgtcaagaagcgggacgagctgggcttccggcctgagtacagtgccagtcag
ctcaagggctttagcctcctctctgcagaagacaaagaagctctgaagaagcagctcccg
gccatcaagaatgaaggaaagagaaaaggtgacgaggtggatggaacagatgaagtggcc
aaaaagaaatctaagaaagggaaggacaaggatagtagtaagctggagaaggccctcaag
gctcagaatgagctgatctggaatatcaaagacgagctgaagaaagcgtgttccaccaac
gacctgaaggagctgctcatcttcaaccagcagcaggtgccgtcaggagagtcagcgatc
ttggacagagttgctgacggcatggcgtttggggcccttctgccctgcaaggagtgttca
ggccagctggtctttaagagcgacgcttattactgtactggggatgtcactgcctggacc
aagtgcatggtcaagacacagaatcctagccgaaaggaatgggtaactccaaaggaattc
cgagaaatatcctacctcaagaagttaaaggtcaaaaaacaggaccgaatattccctcca
gaaagcagcgccccagcaccactggcactgcccctctctgtcacctcagcacccacagct
gtgaactcctctgctccagcagacaagcccctgtctaacatgaagatcctgactcttggg
aagctctcccagaacaaggacgaagcaaaagctgtgattgagaaactcggaggcaagttg
acaggatctgccaacaaggcctccttgtgtatcagcactaaaaaggaggtggagaagatg
agtaagaagatggaggaagtgaaagcggccaacgttcgagttgtgtgtgaggacttcctc
caggacgtgtctgcctccactaaaagcctccaagagctgctctcggcccacagcttgtcc
tcgtggggggctgaggtgaaggcagagcctggtgaagtggtggcccccaaggggaagtca
gctgcaccctccaagaagagcaagggtgctgtcaaggaggaaggtgtcaacaaatctgaa
aagaggatgaaattaactctgaagggaggagcagccgttgatcctgactctggtctggaa
cactctgcacacgtcctggagaaaggtgggaaggtgttcagcgccacacttggcctggtg
gacattgtgaaagggacgaactcctattacaaactgcagcttctggaggacgacaaggag
agcaggtactggatcttccggtcctggggccgggtgggcacagttatcggcagtaacaaa
cttgagcagatgccctccaaagaggacgctgttgagcacttcatgaagctgtatgaagag
aagactgggaatgcctggcactcgaaaaacttcacaaagtatcccaagaagttctaccct
ctggagattgactatggccaggacgaagaggcagtaaagaagctgacggtgaagcctggc
accaagtcgaagctgccgaagccagtgcaggagctcgtggggatgatcttcgacgtggag
agcatgaaaaaggccttggtggagtacgagattgacctccagaagatgcccttggggaag
ctgagcagaaggcagatccaggccgcctactctatcctcagcgaggtccagcaggcagtg
tctcaaggcagcagtgaatcccagatcctagatctctccaatcgcttctacactctgatc
ccccatgactttggaatgaagaagcccccactcctgaacaacgcagacagcgtgcaggcc
aaggtggagatgctagacaacctcctggacatcgaggtggcctatagtcttctcaggggt
ggctctgacgacagcagcaaggatcccatcgacgtcaactacgagaaactcaaaactgac
attaaggtggttgacagagattctgaagaggccgaggtcatcaggaagtacgtgaagaac
actcatgctaccacgcacaacgcctatgacctggaagtgatcgatatcttcaagatagag
cgcgagggggagagccagcgctacaagcccttcaggcagcttcacaaccggaggctgctg
tggcacggctccaggaccaccaactttgctggcatcctgtcgcagggtctgcggatagcc
ccacctgaagcgcctgtgacaggctacatgtttgggaaagggatctactttgccgacatg
gtgtccaaaagtgcaaactactgccacacatctcagggagacccgattggcttaatactg
ctgggagaggttgcccttggaaacatgtatgaactcaagcatgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggaaaaaccacccctgacccttcggcc
agcatcaccctggagggtgtagaggttccactgggaacagggatcccatctggtgtcaac
gacacctgcctgctgtataatgagtacattgtctacgacattgctcaggtgaatctcaaa
tacctgctgaaactcaagttcaattttaagacatccctgtggtaa

KEGG   Mus musculus (mouse): 11546Help
Entry
11546             CDS       T01002                                 

Gene name
Parp2, ADPRT-2, ARTD2, Adprt2, Adprtl2, Aspartl2, C78626, PARP-2, mPARP-2, pADPRT-2
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    11546 (Parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11546 (Parp2)
   04217 Necroptosis
    11546 (Parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11546 (Parp2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11546 (Parp2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11546 (Parp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     11546 (Parp2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     11546 (Parp2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11546 (Parp2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     11546 (Parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 11546
NCBI-ProteinID: NP_033762
MGI: 1341112
Ensembl: ENSMUSG00000036023
UniProt: O88554
LinkDB All DBs
Structure
PDB: 

Position
14 26.25 cM; 14 C1
AA seq 559 aa AA seqDB search
MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcggcggcagagatcaggctctggaaggcgagtgctaaatgaagccaagaaa
gttgataatggcaacaaagcaacagaagacgactctcctcctggcaagaagatgcgcacg
tgccagagaaaagggcctatggctggagggaaggacgcagacaggacaaaagacaatcga
gactctgtgaagaccttgctgttaaagggcaaagcccctgtggacccagagtgtgcagcc
aagctgggaaaggctcatgtgtattgtgaaggagatgatgtctatgatgtcatgctaaat
caaaccaatctccagttcaacaacaacaagtactaccttattcagctgttagaagatgat
gcccagaggaacttcagtgtttggatgaggtggggccgagttggaaagacggggcagcac
agcttggtgacttgttctggtgacctcaacaaagcaaaagaaatatttcagaaaaaattc
cttgacaaaactaaaaacaattgggaggaccgtgagaactttgaaaaagtacctggaaaa
tacgacatgttacagatggactatgctgccagcacgcaggatgaaagtaaaacaaaagaa
gaggaaactttgaagcctgagtctcagctggatcttcgagtccaggagctgctaaagttg
atctgtaacgtgcagaccatggaagaaatgatgattgagatgaagtatgacaccaagaga
gccccgcttggaaagctgacagtggcgcaaatcaaggccggttaccagtctctcaagaag
attgaggactgcatccgcgctggccagcatgggcgagcgcttgttgaagcgtgcaatgaa
ttctacaccaggatccctcatgactttggactctccatccctccagtaatccggacagag
aaggaactgtcagacaaagtaaaactgctagaggcattgggagacattgaaattgccctt
aaactggtgaagtcagagcgccaaggcctagaacacccactggaccaacactatagaaac
ctacactgtgctttgcgtcctctggaccatgaaagtaatgagtttaaggtgatttctcag
tacctacagtctacgcatgctcctacacacaaggactatactatgaccttgctggatgtt
ttcgaagtagagaaggaaggggagaaagaggccttcagggaggaccttcctaacaggatg
ctgctctggcatggatccaggctgagtaactgggtggggatcctgagccacgggcttaga
gttgccccacctgaggctcccatcacaggttatatgtttggaaaaggaatctactttgct
gacatgtcctccaagagtgccaattactgctttgcctctcgcctaaagaatacaggattg
cttcttctgtcagaggtagctctaggtcagtgtaatgaactactggaggccaatcctaaa
gcacaaggattgcttcggggcaagcatagcaccaaggggatgggaaagatggctcccagc
cctgcccacttcatcaccctgaatgggagtacagtgcccttaggaccagcaagtgacaca
ggaattctcaatccagaggggtacaccctcaactacaatgagtttattgtttatagcccc
aaccaggtccgtatgcgataccttctaaagattcaatttaacttcctgcagctatggtga

KEGG   Mus musculus (mouse): 235587Help
Entry
235587            CDS       T01002                                 

Gene name
Parp3, A930002C11Rik, ADPRT-3, ARTD3, AW990611, Adprt3, Adprtl3, PARP-3, pADPRT-3
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    235587 (Parp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    235587 (Parp3)
   04217 Necroptosis
    235587 (Parp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    235587 (Parp3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    235587 (Parp3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    235587 (Parp3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     235587 (Parp3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     235587 (Parp3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    235587 (Parp3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     235587 (Parp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 235587
NCBI-ProteinID: NP_001298079
MGI: 1891258
Ensembl: ENSMUSG00000023249
Vega: OTTMUSG00000033581
UniProt: Q3ULW8
LinkDB All DBs
Position
9; 9 F1
AA seq 533 aa AA seqDB search
MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPADNRVIRVDPSCPFSRNPGIQV
HEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQSKMNHFTCLEDAKK
DFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKALSPQVYSGPVRTVVK
PCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMK
NPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTLQAA
PGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLRHVWK
VNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPA
QDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRYLLEIHL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaacgaaaggcctctgtgcagactgagggctccaagaagcggcgacaaggg
acagaggaggaggacagcttccggtccactgccgaggctctcagagcagcacctgctgat
aatcgggtcatccgtgtggacccctcatgtccattcagccggaaccccgggatacaggtc
cacgaggactatgactgtaccctgaaccagaccaacatcggcaacaacaacaacaagttc
tatattatccaactgctggaggagggtagtcgcttcttctgctggaatcgctggggccgc
gtgggagaggtgggccagagcaagatgaaccacttcacctgcctggaagatgcaaagaag
gactttaagaagaaattttgggagaagactaaaaacaaatgggaggagcgggaccgtttt
gtggcccagcccaacaagtacacacttatagaagtccagggagaagcagagagccaagag
gctgtagtgaaggccttatctccccaggtgtacagcggccctgtgaggaccgtggtcaag
ccctgctccctagaccctgccacccagaaccttatcaccaacatcttcagcaaagagatg
ttcaagaatgcaatgaccctcatgaacctggatgtgaagaagatgcccttgggaaagctg
accaagcagcagattgcccgtggcttcgaggccttggaagctctagaggaggccatgaaa
aaccccacaggggatggccagagcctggaagagctctcctcctgcttctacactgtcatc
ccacacaacttcggccgcagccgacccccgcccatcaactcccctgatgtgcttcaggcc
aagaaggacatgctgctggtgctagcggacatcgagttggcgcagaccttgcaggcagcc
cctggggaggaggaggagaaagtggaagaggtgccacacccactggatcgagactaccag
ctcctcaggtgccagcttcaactgctggactccggggagtccgagtacaaggcaatacag
acctacctgaaacagactggcaacagctacaggtgcccagacctgcggcatgtttggaaa
gtgaaccgagaaggggagggagacaggttccaggcccactccaaactgggcaatcggagg
ctgctgtggcacggcaccaatgtggccgtggtggctgccatcctcaccagtgggctccga
atcatgccacactcgggtggtcgtgttggcaagggtatttattttgcctctgagaacagc
aagtcagctggctatgttaccaccatgcactgtgggggccaccaggtgggctacatgttc
ctgggcgaggtggccctcggcaaagagcaccacatcaccatcgatgaccccagcttgaag
agtccaccctctggctttgacagcgtcatcgcccgaggccaaacggagccggatcccgcc
caggacattgaactcgaactggatgggcagccggtggtggtgccccaaggcccgcctgtg
cagtgcccgtcattcaaaagctccagcttcagccagagtgaatacctcatatacaaggag
agccagtgtcgcctgcgctacctgctggagattcacctctaa

KEGG   Mus musculus (mouse): 328417Help
Entry
328417            CDS       T01002                                 

Gene name
Parp4, ARTD4, Adprtl1, C030027K23Rik, E230037B21Rik, Gm743, PARP-4, PARPL, PH5P, VAULT3, VPARP, p193
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 4
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    328417 (Parp4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    328417 (Parp4)
   04217 Necroptosis
    328417 (Parp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    328417 (Parp4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    328417 (Parp4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    328417 (Parp4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     328417 (Parp4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     328417 (Parp4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    328417 (Parp4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     328417 (Parp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VIT PARP Drf_FH1 VIT_2 VWA_3 VWA BRCT_2 BRCT VWA_2 PTCB-BRCT PARP_reg
Motif
Other DBs
NCBI-GeneID: 328417
NCBI-ProteinID: NP_001139450
MGI: 2685589
Ensembl: ENSMUSG00000054509
Vega: OTTMUSG00000034672
UniProt: E9PYK3
LinkDB All DBs
Position
14; 14 C3
AA seq 1969 aa AA seqDB search
MTLGIFANCIFCLKVKYLPRQQKKKLQTDIKENGGKFSFLLNPQCTHVIVDSADVLSRCH
LNSIQKNDVQIANPAFIQDSVRQRRLLDVRNYDPLSPAPAAPPAERSRSEVQSEYLPSDN
TPEKENTEVTEVSAENVEIPPFLQDFEVVKYNILEKVGGPETVVVELQSSQDPESCPFVI
TAHFLLADQKTRRESTGKQTSEGAIEYYESYVEDLKRQGFLLQEHFTAEATQLASEKLQA
LLLEEVISSGALSQEVSDLLEVIWTEALGHLENTLLKPVNSMSLNDVSKAEGILLLVKTA
LKNGDSPGQLQKTMAEFYRLLPHRHPASEEVNLRLLAQKEDLCQLVRDMVNVCETNLSKP
NPPSLAKYRALRCKIEHVDQNTEEFSRVRKEVLQNNRSEQPVDILQIFRVGRVNEATEFL
SKLGNVRLLFHGSPVRNILGILSRGLLLPKVAEDRGVQRTDVGNLGSGIYFSDSLSTSIK
YAHAGETDGSRLLVVCDVALGKCVNLFKKDFSLTEAPPGYDSVHGVSETTSVPTDFQDDE
FVVYKTNQVKMKYIVKFCTPGDQIKEFHPHENTEVEEQRAEPSSVPEAGDFQLPDIKPFT
NIKAGLQDASANPVPLDSVHIKGRVIDFVAQVIVFQTYTNQSHVPIEAKYIFPLDDKAAV
CGFEAFINGKHIVGEIKEKEEARQEYREAVSQGHGAYLMDQDTPDVFTVSVGNLPPRAKV
LIKITYITELSIQSPVAIFFIPGTVAPWQQDKALNENLQDTVETIRIKEIGAEQSFSLAM
SIEMPYMIEFISSDTHELRQKSTDCKAVVSTVEGSSLDSGGFSLHIGLRDAYLPRMWVEK
HPEKESEACMLVFQPELADVLPDLRGKNEVIICLDCSSSMEGVTFTQAKQVALYALSLLG
EEQKVNIMQFGTGYKELFSYPKCITDSKMATEFIMSAAPSMGNTDFWKVLRYLSLLYPSE
GFRNILLISDGHLQSESLTLQLVKRNIQHTRVFTCAVGSTANRHILRTLSQCGAGVFEYF
NSKSKHSWKKQIEAQMTRIRSPSCHSVSVKWQQLSRDAPEPLQAPAWVPSLFHNDRLLVY
GFIPHCTQATLQAFIQEKEFCTMVSTTELQKTTGTMIHKLAARALIRDYEDGILHDDETN
HEMKKNIMKSLIIELSKENSLITQFTSFVAVEKRDVNEIPFANVPNISELVAKEDVDFLP
YVSWQEKQPEASISQTEIDSSRLKHNKLSDGHGVLQPVSVSSEVNEKPSLLLAAKKRKIK
TIKKCSLDISEDFEDRTAVAQSPATAQSLNFHLPLSVRPQLKAVEQQLHGNRLEPKQRGG
FRKLLMAKKCRNVPDSLVSSAPAVTAEFSYLSACSSSSAFLSPLCDIPSSLPPHPLGGTH
PPPPLPLPDGTHLPSPLFGSTHPPPPLFGGTLIPPPSSLFGGTHLPPPPPLPGGTHIPPP
PPIPGGTLIPPSSSLFGGTHLPPPPLLSAGTHIPPPPLLSAGTHLPPPPLLPAGTHIPPP
PPITGSTHPPPPSSLFGGTHLPPPPPLPGGTHIPPPPPIPGGTLIPSPSSLFGGTHLPPP
PLLPAGTHIPPPPPITGSTHPPPPSSLFGGTHLPPPPPAGTQFSLSPIGFIPPKLGPPKL
SHSHKLVGDTNIHDSEPPLLGFKDLCSRDMGFSCGTAFSGSFASSKDFDPGKFSQGPNNI
SFSPKAPEMGVLHQSPFCSPPKPPSAPPLVTNVLCSEAPQSYFLNLQSAAVHQSPNNRVS
EIIMESVESSLPSDYSSRDASSYLALEGAEDSLLGGSSFETDTDEAAAFIANDLLTSIET
SSDEECAFCDEDQESPVPWASLFALQTENGFWKLTPELGLILNLNVNALLTSLEEKGIRS
LGTKGRERLLDLIATLLVLQFLYTKLEQEGMVAKSLIKMDDAFISRNIPWAFENIKKARE
WARKTEGQYPSICQRLELGKDWESATKQLLGIQPQANTSLHRILYYSQG
NT seq 5910 nt NT seq  +upstreamnt  +downstreamnt
atgactttaggaatctttgcaaattgtatattctgcttgaaggtcaagtacttacctcgt
cagcagaagaaaaagctgcaaactgatattaaggaaaatggcggaaagttttccttttta
ttaaaccctcagtgcacacatgtcatcgtagacagtgctgacgtcctgagtcggtgtcat
ctgaactccatccaaaagaacgatgtgcagattgccaacccagcattcatccaggactct
gtgagacagaggagactcctggatgtgaggaattatgatcctctgtcgccggctccagca
gcaccaccagctgaaaggagcaggtctgaagtgcaatcagaatatctgccttcagacaac
accccagagaaggaaaacaccgaagtcactgaggtttctgcagagaatgttgaaattccc
ccctttcttcaagactttgaagttgtgaaatataacatcttggaaaaggtaggaggcccc
gagactgtggtggtagagctgcagagctcccaggacccagagagctgcccctttgtgata
acagcacacttcctcctggctgatcaaaagaccaggagagagagcactggaaagcaaact
tctgaaggtgcaattgaatattatgaaagttatgtggaagacctgaagagacaaggattt
ctgctccaagaacactttacggccgaagcaacacagttagcgtctgagaaactgcaggcg
ttgcttttggaggaggtcattagttcaggcgccctgagccaggaggtgagcgatttgctg
gaggtgatctggacagaagctctgggccacctggagaacacgctcctcaagccagtgaac
agcatgagcctgaatgacgtgagtaaagcagagggaattctccttctggtgaagacagcc
ctgaagaatggagactcgcccggacaactgcagaagacaatggccgagttctaccgcttg
ctgcctcacaggcatccagcctcagaggaagttaacctgaggctgttggctcaaaaagag
gacctttgtcagctggtaagagacatggtgaatgtttgtgaaactaatttatccaaaccc
aacccaccatctcttgccaaataccgtgctttgcgatgcaaaatcgaacatgttgaccag
aacactgaagaattttccagggttagaaaagaagtgttgcagaataatcgaagtgaacaa
ccagtagatatcttgcagatatttagagttggcagagtgaatgaagctacggagttttta
agcaaactgggcaacgtgcgactcttatttcatggatctcctgtgcggaacattcttgga
atcttgtcccgagggctgctcttacctaaggtagctgaagaccgcggtgtacagagaaca
gatgttggaaatctcgggagcgggatctacttcagcgactcactcagtacaagcattaag
tatgcacacgcaggagagacagatgggtccagactcctggtcgtctgtgacgttgccctg
ggaaagtgtgtgaacttattcaagaaggacttttctttaactgaggcgccaccaggctat
gacagtgtgcatggagtttcggaaaccacctctgtccccacagactttcaggacgatgaa
tttgttgtatataaaaccaaccaagttaaaatgaaatacattgttaaattttgcactcct
ggagatcaaataaaggaattccatcctcatgaaaataccgaagtagaggagcaaagggct
gagccctccagtgttccagaggctggagatttccagttaccagacatcaagcccttcaca
aacatcaaagccggccttcaggatgcatctgcgaatcctgttcctcttgacagtgttcac
attaagggaagagtaatagacttcgtagcccaggtcattgtttttcagacatacacgaat
caaagccacgtgcctattgaggcaaaatatatcttcccattggatgacaaagcagctgtg
tgtggcttcgaggcattcatcaatgggaagcacattgtgggagagataaaggaaaaggaa
gaggcccggcaggagtaccgagaggctgtcagccaaggccatggtgcttacttgatggac
caggacactccggatgttttcactgtaagtgttggaaacttaccccctcgggctaaagtc
ctcatcaaaatcacctacatcacggaactcagcatccagagtcctgtggccatcttcttc
atccctggcactgtagcaccctggcaacaggacaaggcgttgaatgagaaccttcaggat
acagtggagacaattcgtataaaggaaattggagcagagcaaagcttctccctggctatg
tccattgagatgccctacatgattgaattcatttccagtgacacacatgaactgagacaa
aagagcacagactgtaaagctgtggttagcactgtggaaggcagctccttggacagcggt
ggattttctctccacattggtttgcgtgatgcatacctcccaagaatgtgggttgaaaaa
catccagaaaaagaaagcgaggcctgcatgcttgtctttcaaccggagcttgcggacgtc
ctccctgacctccgtggaaagaacgaagtgattatttgtcttgactgttccagttccatg
gagggtgtgacattcacacaagccaagcaggttgccctgtatgctctgtctttgctgggt
gaagagcagaaagtcaacattatgcaatttggcacaggttacaaggaactgttttcatat
cctaagtgcatcacggacagtaaaatggccacagagttcattatgtctgcagcaccttcc
atggggaacacagacttctggaaagttctccgctatttaagtctcctgtacccttcagaa
gggttccggaacattctcctcatatctgatgggcacctccagagtgagagtctgacactg
cagcttgtgaaaagaaatatccagcacaccagagtgttcacctgtgctgttggttccaca
gcaaatcgtcacatcttaaggaccttgtctcagtgtggcgctggagtatttgaatatttt
aactcaaaatctaagcacagttggaaaaaacagatagaagctcaaatgaccaggatacgt
tccccaagttgccactctgtctctgtcaaatggcagcagcttagcagagatgcccccgag
cctctgcaggccccggcatgggtgccctctttgttccacaatgatcgactcctggtctac
ggcttcattcctcattgtacacaagcaactctgcaagcattcatccaagagaaagaattt
tgcacaatggtgtcaactacagagcttcagaagacaactgggactatgattcacaagctg
gcagcccgggcactaatcagagattatgaagacggcattctccacgacgatgaaaccaac
cacgagatgaagaaaaacatcatgaaatctctgattatcgaactcagtaaagaaaattct
cttattacacaatttacaagctttgtggcagttgagaaaagggacgtaaatgagattcct
tttgctaatgtcccaaatatttcggaacttgttgccaaagaagatgttgactttctacca
tacgtgagttggcaggaaaagcaaccagaggcctccatatcacagacagagattgattct
tcgagactaaagcacaataaactctctgatggccatggagtgctacagcccgtttccgtc
tcctctgaagtgaatgagaaaccatcactgctactcgctgctaaaaaaaggaaaataaag
actataaagaagtgcagtctagacatttctgaagattttgaagacaggactgcagtagca
cagtcacctgcaacagcgcagtctcttaatttccacctgcctctcagtgtccgcccacaa
ctgaaagctgtggagcagcagctgcatgggaaccggctggagccaaagcaaaggggagga
tttcgaaaactgctcatggcaaagaagtgtcgaaatgtgcctgattccctggtttcctct
gctcctgcagtcacagctgagttttcttacctttctgcctgcagctctagttctgccttc
ctgtctcctctctgcgacatcccttcttctcttcctccccatccccttggtggtacccac
cctcctccccctcttcctctccctgatggcacccatcttccttcccctctctttggtagc
acccaccctcctccccctctctttggtggcacccttattcctcccccttcttctcttttt
ggtggcacccatcttcctccccctccccctctccctggtggcacccatattcctccccct
ccacctatccctggtggcacccttattcctccctcttcttctctctttggtggcacccat
cttcctccccctccccttctctctgctggcacccatattcctccccctccccttctctct
gctggcacccatcttcctccccctccccttctccctgctggcacccatattcctccccct
ccccctatcactggcagcacccaccctcctcccccttcctctctctttggtggcacccat
cttcctccccctccccctctccctggtggcacccatattcctccccctccacctatccct
ggtggcacccttattccttccccttcttctctctttggtggcacccatcttcctccccct
ccccttctccctgctggcacccatattcctccccctccccctattactggcagcacccac
cctcctcccccttcctctctctttggtggcacccatcttcctccccctccccctgctggc
acccaattttctctttctcctataggattcataccacctaagttgggtccacctaagctt
agccacagccataaacttgtcggagataccaacatccatgactcagagccacctctcctg
ggctttaaggatttgtgctctagagatatgggctttagttgtggtaccgctttctcaggt
agctttgctagttcaaaggattttgatccaggtaaattttcccaaggccccaacaacatc
agcttctctcccaaagcccctgagatgggcgttcttcaccagtcacctttttgcagtcct
cctaagccaccttctgcccctcctcttgtcaccaacgtactttgctctgaggctcctcag
agctattttcttaatttgcaaagtgccgcagtgcatcagagccctaataacagagtgtca
gagatcatcatggagtcagttgagtcatctctcccatcagattactcttccagagatgcg
tcatcatacttggctctagaaggggcagaagactccttgctgggtggaagttcttttgaa
accgatacagatgaagcagcagcatttatagccaatgatcttttaacaagtattgagact
tcctcagatgaggaatgtgccttctgtgatgaagaccaggagagtcctgtgccgtgggct
tcactctttgctctacagactgagaatggtttttggaagctgacaccagaactaggactt
atattaaaccttaatgtaaatgctctgctcacttctcttgaagaaaagggcattcgatct
ctaggtacaaaagggcgagagcgtctcctggatctgattgccactttgctcgtactgcag
tttctttataccaagttggaacaagaaggaatggttgccaagtctctgataaagatggat
gacgccttcatttctaggaatattccatgggcttttgagaacataaagaaagcaagagaa
tgggccagaaagacagaaggacagtatccatctatctgccaacggcttgagctgggtaaa
gactgggagtcagccacaaagcaactactgggaattcagccccaagccaacacttctctt
caccgaattctatactacagccaaggctga

DBGET integrated database retrieval system