KEGG   Mus musculus (mouse): 11607Help
Entry
11607             CDS       T01002                                 

Gene name
Agtr1a, 1810074K20Rik, AG2S, AI551199, AT1, AT1a, AT2R1, AT2R1A, Agt1ar, Agtr-1a, Agtr1, Angtr-1a
Definition
(RefSeq) angiotensin II receptor, type 1a
  KO
K04166  angiotensin II receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    11607 (Agtr1a)
   04020 Calcium signaling pathway
    11607 (Agtr1a)
   04072 Phospholipase D signaling pathway
    11607 (Agtr1a)
   04022 cGMP-PKG signaling pathway
    11607 (Agtr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11607 (Agtr1a)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11607 (Agtr1a)
   04614 Renin-angiotensin system
    11607 (Agtr1a)
   04925 Aldosterone synthesis and secretion
    11607 (Agtr1a)
   04927 Cortisol synthesis and secretion
    11607 (Agtr1a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11607 (Agtr1a)
   04270 Vascular smooth muscle contraction
    11607 (Agtr1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11607 (Agtr1a)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    11607 (Agtr1a)
   04934 Cushing syndrome
    11607 (Agtr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11607 (Agtr1a)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11607 (Agtr1a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    11607 (Agtr1a)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Angiotensin
    11607 (Agtr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 11607
NCBI-ProteinID: NP_796296
MGI: 87964
Ensembl: ENSMUSG00000049115
Vega: OTTMUSG00000000668
UniProt: P29754
LinkDB All DBs
Position
13 A3.2; 13 13.19 cM
AA seq 359 aa AA seqDB search
MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVC
AFHYESRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccttaactcttctactgaagatggcatcaaaagaattcaagatgactgccccagg
gctggcaggcacagttacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagcttggtggtgatcgtcatctacttttacatgaagctgaag
actgtggccagtgtctttcttctaaatctcgccctggctgacttatgctttttgctgact
ttgcccctgtgggctgtctataccgctatggaataccgctggcccttcggcaatcaccta
tgtaagatcgcttcggccagcgtcagtttcaacctctacgccagcgtgttcctgctcacg
tgtctcagcatcgatcgctacctggccattgtccacccgatgaagtctcgcctccgccgc
acgatgctggtggccaaagtcacctgcatcatcatctggctgatggctggcttggccagt
ttgccagccgtcatccaccgaaatgtgtatttcattgagaacaccaatatcactgtttgc
gcttttcattacgagtcccggaattcaacgctccccataggactgggcctaaccaagaac
atcctgggcttcctgttccctttcctaatcattcttaccagctatactcttatatggaaa
gctctaaagaaggcttatgaaattcagaagaacaagccaagaaatgatgacatctttagg
ataattatggcgattgtgcttttcttcttcttctcctgggtcccccaccaaatattcaca
ttcctggatgtgctgattcagctgggcgtcatccatgactgtaaaattgccgacatcgtg
gacactgccatgcccataaccatctgcatagcgtattttaacaactgcctgaaccctctg
ttttacggctttctggggaaaaaatttaaaaagtatttcctccagctcctgaaatatatt
cccccaaaggccaagtcgcactcaagcctgtctacgaaaatgagcacgctctcctaccgc
ccctcagataacatgagctcagccgccaaaaagcctgcgtcttgttctgaggtggagtga

KEGG   Mus musculus (mouse): 11608Help
Entry
11608             CDS       T01002                                 

Gene name
Agtr1b, AT1B, AT2R1B, Agtr-1b, Angtr-1b
Definition
(RefSeq) angiotensin II receptor, type 1b
  KO
K04166  angiotensin II receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    11608 (Agtr1b)
   04020 Calcium signaling pathway
    11608 (Agtr1b)
   04072 Phospholipase D signaling pathway
    11608 (Agtr1b)
   04022 cGMP-PKG signaling pathway
    11608 (Agtr1b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11608 (Agtr1b)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11608 (Agtr1b)
   04614 Renin-angiotensin system
    11608 (Agtr1b)
   04925 Aldosterone synthesis and secretion
    11608 (Agtr1b)
   04927 Cortisol synthesis and secretion
    11608 (Agtr1b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11608 (Agtr1b)
   04270 Vascular smooth muscle contraction
    11608 (Agtr1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11608 (Agtr1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    11608 (Agtr1b)
   04934 Cushing syndrome
    11608 (Agtr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11608 (Agtr1b)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11608 (Agtr1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    11608 (Agtr1b)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Angiotensin
    11608 (Agtr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 11608
NCBI-ProteinID: NP_780295
MGI: 87965
Ensembl: ENSMUSG00000054988
Vega: OTTMUSG00000034694
UniProt: P29755 Q32MF7 Q8BU69
LinkDB All DBs
Position
3 A2; 3 6.37 cM
AA seq 359 aa AA seqDB search
MILNSSIEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYQWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFVIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFSFLDVLIQLGVIHDCEIADVVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKRYFLQLLKYIPPKARSHAGLSTKMSTLSYRPSDNMSSSARKSAYCFEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatccttaactcttctattgaagatggaattaaaagaatccaagatgactgccccaag
gctggcaggcacaattacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagtttggtggtaattgtcatttacttttacatgaagctaaag
actgtggccagtgttttccttctgaatcttgccctggctgatttatgctttttgttgact
ttgcctctgtgggcagtttataccgctatggaataccagtggcccttcggcaatcaccta
tgtaagatcgcttcggccagcgtcagtttcaacctctacgccagtgtgttcctgctcacg
tgtctcagcatcgatcgctacctagccattgtccacccaatgaagtctcgcctccgacgc
acaatgctggtcgccaaagtcacctgcatcatcatctggctgatggctggcttggctagt
ttgccggccgtcatccaccgaaatgtgtatttcatcgagaacaccaatatcacagtttgt
gcttttcattatgaatctcagaactcaacactccccattggactgggtctgaccaagaac
attctgggcttcgtgttccctttcgttattattctcaccagctatactctgatttggaaa
gccctaaagaaggcttacaaaattcagaagaatacgccaaggaatgatgacatctttagg
ataatcatggcgattgtgcttttcttcttcttttcctgggttccccaccaaatattcagt
tttctggatgtgctcattcagctgggcgtcatccatgactgtgaaattgcggacgtagtg
gacactgctatgcccatcaccatctgcatagcttattttaacaattgcctgaaccctctg
ttttatggctttctggggaaaaaatttaaaagatatttcctccagcttctgaaatatatt
cccccaaaggccaggtcgcatgcagggttatcaacaaaaatgagtactctttcctaccgc
ccttcagataacatgagctcgtctgccaggaagtctgcgtattgttttgaagtggagtga

KEGG   Mus musculus (mouse): 14062Help
Entry
14062             CDS       T01002                                 

Gene name
F2r, AI482343, Cf2r, Par1, ThrR
Definition
(RefSeq) coagulation factor II (thrombin) receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14062 (F2r)
   04020 Calcium signaling pathway
    14062 (F2r)
   04072 Phospholipase D signaling pathway
    14062 (F2r)
   04024 cAMP signaling pathway
    14062 (F2r)
   04151 PI3K-Akt signaling pathway
    14062 (F2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14062 (F2r)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14062 (F2r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14062 (F2r)
   04611 Platelet activation
    14062 (F2r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14062 (F2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14062 (F2r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thrombin
    14062 (F2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 14062
NCBI-ProteinID: NP_034299
MGI: 101802
Ensembl: ENSMUSG00000048376
UniProt: P30558
LinkDB All DBs
Position
13 D1; 13 50.21 cM
AA seq 430 aa AA seqDB search
MGPRRLLIVALGLSLCGPLLSSRVPMSQPESERTDATVNPRSFFLRNPSENTFELVPLGD
EEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYLTSPWLTLFMPSVYTIVFIV
SLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMC
RFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVV
PLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSAIFFLVPLIVSTVCYTSIIR
CLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLFLSDSPGTEAAYFAYLL
CVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNSCNSTGQLMPSKMDTCSSHL
NNSIYKKLLA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggggccccggcgcttgctgatcgtcgccctcggcctcagcctgtgcggtcccttgctg
tcttcccgcgtccctatgagccagccagaatcagagaggacagatgctacggtgaacccc
cgctcattctttctaaggaatcccagtgaaaatacatttgaactggtccccctgggggat
gaggaggaggaggagaaaaatgaaagcgtcctgctggagggtagggcagtctacttaaat
ataagcctccctcctcacacgccgcctcctcccttcatctccgaggacgcctccggatat
ctgaccagcccctggctgacgctcttcatgccctccgtgtacacgattgtgttcattgtc
agccttcctctgaacgtcctggccatcgcagtgttcgtcttgaggatgaaggtcaagaag
ccggccgtggtgtacatgctgcacctggccatggccgacgtgctcttcgtgtcggtgctc
cccttcaagatcagctactacttctccggcactgattggcagttcgggtctggaatgtgc
cgcttcgccaccgcagcgttttacgggaacatgtacgcctccatcatgctcatgacggtc
ataagcattgaccggttcctggcggtggtgtatccgatccagtccctgtcctggcgcact
ctgggccgagccaacttcacttgcgtggtcatttgggtgatggccatcatgggggtggtg
ccccttctcctcaaggagcagaccacccgagttccgggactcaacatcaccacctgccac
gacgtcctcagtgagaacctgatgcaaggcttttactcgtactacttctcggccttctcc
gccatcttctttcttgtgccgttgatcgtttccacggtctgctacacgtccatcatccgg
tgcctgagctcctccgcggttgccaaccggagcaagaagtcgcgggctttgttcctgtct
gccgcggtgttctgcatcttcatcgtctgctttgggcccaccaacgtcctcctgattgtg
cactaccttttcctctccgacagtcctggtacagaggcagcctactttgcttacctcctc
tgcgtctgtgtgagcagcgtgagctgctgcatcgatccgttgatttactactacgcctcc
tccgagtgccagaggcacctctacagcatcttgtgctgcaaagaaagctctgatcccaac
agttgcaacagcaccggccagctgatgccgagtaaaatggatacctgctctagtcacctg
aataacagcatatacaaaaagctattagcttag

KEGG   Mus musculus (mouse): 14065Help
Entry
14065             CDS       T01002                                 

Gene name
F2rl3, PAR4
Definition
(RefSeq) coagulation factor II (thrombin) receptor-like 3
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14065 (F2rl3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14065 (F2rl3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14065 (F2rl3)
   04611 Platelet activation
    14065 (F2rl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14065 (F2rl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14065 (F2rl3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thrombin
    14065 (F2rl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 14065
NCBI-ProteinID: NP_032001
MGI: 1298207
Ensembl: ENSMUSG00000050147
Vega: OTTMUSG00000062066
UniProt: O88634
LinkDB All DBs
Position
8 35.08 cM; 8 B3.3
AA seq 396 aa AA seqDB search
MCWPLLYPLVLGLSISLAEGIQTPSIYDDVESTRGSHEGPLGPTVELKEPKSSDKPNPRG
YPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVPR
LPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLA
AVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRMLC
HDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTALV
LFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFR
EKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggccgctgctgtatcctttggtgctggggctcagcatcagcctggcagagggc
atccagacccccagcatctacgatgatgtagagagtaccaggggaagccatgaaggccct
ctgggtcccacagtagaactcaaggagccgaagtcctcagacaagcctaatccacgaggc
tacccgggcaaattctgtgccaacgacagtgacacgctggagctcccggccagctctcaa
gcactgctgctggggtgggtccccacgaggctggtacctgccctctatgggcttgtggtg
gctgtggggctgcctgccaatgggctggcgctgtgggtgctggccacaagggtgccacgc
ctgccatccaccattctgctcatgaacctggcagtggctgatctgctgttggccctggtg
ctgccaccacgactggcttaccacttgcgtggccagcgctggccatttggtgaggctgcc
tgccgggtggccacagctgccctctatggccacatgtatggttcagtgttgctgctggct
gcagtcagcttggacagatacctggccctggtgcatcctttgcgggcccgtgcactgcgt
ggtcaacgcctcactactggactctgtttggtggcctggctctctgcagccaccctggcc
ttgcctctcactctgcatcggcagaccttccgattagctggctccgatcgcatgctgtgt
catgatgcgctgcccctgactgagcagacctcccactggagaccggccttcatctgcctg
gctgtcctgggctgcttcgtgccactgctggccatgggcctgtgctatggagccaccctt
cgtgcactggcggccaatggccagcgctacagccatgcactcagactgacagccctggta
ctgttctcggcagtggcctctttcacacctagcaatgtgctgctggtgctgcactattca
aacccgagccctgaggcctggggcaatctctatggagcctatgtgcccagcctggcactc
agcaccctcaacagctgcgtagaccctttcatctactactatgtgtcccatgagttcagg
gagaaggtacgcgctatgttgtgtcgccagccggaggccagcagctcctctcaggcctcc
agggaggctggaagccgagggactgccatttgctcctctacacttctgtga

KEGG   Mus musculus (mouse): 14745Help
Entry
14745             CDS       T01002                                 

Gene name
Lpar1, AI326300, Edg2, Gpcr26, Kdt2, lpA1, vzg-1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14745 (Lpar1)
   04072 Phospholipase D signaling pathway
    14745 (Lpar1)
   04151 PI3K-Akt signaling pathway
    14745 (Lpar1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14745 (Lpar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14745 (Lpar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14745 (Lpar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14745 (Lpar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14745 (Lpar1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    14745 (Lpar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 14745
NCBI-ProteinID: NP_034466
MGI: 108429
Ensembl: ENSMUSG00000038668
Vega: OTTMUSG00000007519
UniProt: P61793 Q544V2
LinkDB All DBs
Position
4 B3; 4 32.2 cM
AA seq 364 aa AA seqDB search
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC
VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcctctacttccagccctgtaatttcacagccccagttcacagccatgaac
gaacaacagtgcttctacaatgagtctatcgccttcttttataaccggagtgggaaatat
ctagccacagaatggaacacagtgagcaagctggtgatgggactgggcatcactgtttgc
gtgttcatcatgttggccaatctcctggtcatggtggcaatctacgtcaaccgccgcttc
catttccctatttattacttgatggccaacctggctgctgcagacttcttcgctggattg
gcctacttctacctgatgttcaatacaggacctaatacccggagactgactgttagcacg
tggctcctccggcagggcctcattgacaccagcctgacagcttctgtggccaacctgctg
gctattgctatcgagaggcacatcacggttttccgcatgcagctccatacacgaatgagc
aaccggcgcgtggtggtggtgattgtagtcatctggactatggccattgtgatgggtgct
atacccagtgtgggctggaactgcatctgtgatatcgatcactgttccaacatggcaccc
ctctacagtgactcctacttagtcttctgggccattttcaacctggtgacctttgtggtc
atggtggttctctacgctcacatctttggctatgttcgccagaggactatgaggatgtct
cggcatagttctggacccaggaggaatcgggacaccatgatgagccttctgaagactgtg
gtcattgtgcttggtgcctttattgtctgctggactccgggattggtcttgttattgctg
gatgtgtgctgcccgcagtgcgatgtcctggcctatgagaagttcttcctcctcctggcc
gagttcaactctgctatgaaccccatcatctactcctaccgcgacaaagagatgagcgcc
accttcaggcagatcctgtgttgccagcgcaacgagaaccctaatggccccacggaaggc
tctgaccgctctgcctcctccctcaaccacaccattctggctggagttcacagcaacgac
cactctgtggtttag

KEGG   Mus musculus (mouse): 381810Help
Entry
381810            CDS       T01002                                 

Gene name
Lpar5, GPR93, Gm1072, Gpr92, LPA5
Definition
(RefSeq) lysophosphatidic acid receptor 5
  KO
K08390  lysophosphatidic acid receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    381810 (Lpar5)
   04072 Phospholipase D signaling pathway
    381810 (Lpar5)
   04151 PI3K-Akt signaling pathway
    381810 (Lpar5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    381810 (Lpar5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    381810 (Lpar5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    381810 (Lpar5)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    381810 (Lpar5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 381810
NCBI-ProteinID: NP_001156740
MGI: 2685918
Ensembl: ENSMUSG00000067714
Vega: OTTMUSG00000022555
UniProt: Q149R9 G3X9K0
LinkDB All DBs
Position
6; 6 F2
AA seq 372 aa AA seqDB search
MFANSSANTTSTNSSVLQCPDYRDTHRLHMVVYSLVLATGLPLNALALWVFLRVLRVHSV
VSVYMCNLAASDLLFTLSLPLRLSYYAQHHWPFPGFLCQTSGAIFQMNMYGSCLFLMLIN
VDRYAAIVHPLRLRHLRRPRVARRLCLGVWALILLFAVPAARVHSPSHCTYKNITVRLCF
ESFSDELWKGRLLPLLLLAEILGFLLPLAAVVYSSGRVFWTLARPDATQSQRRRKTVRLL
LANLIIFLLCFVPYNSTLAVYGLLRANLVKNSIQDRDQVRGVLMIMVLLAGANCVLDPLV
YYFSAEGFRNTLRNLGAPLNTRPLATNGAAGVLTELPSESTQNTGQDATSQVLLQPATLG
TPPDNCSQDSAL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccaattcttcagccaacacgacttctaccaacagctctgtgctccagtgccct
gactatcgagatacacatcgtttgcatatggtggtctacagcctggtattggcgactggt
ctccctctcaacgctctggctctctgggtcttcctgcgtgtactgcgcgtacactcagtg
gtgagcgtgtacatgtgcaacctggcagccagcgacttgctcttcaccctgtcacttccc
ctgcgcctctcctactatgcacagcaccactggccttttccaggcttcctgtgccagacg
tcgggcgccatcttccagatgaacatgtacggcagctgtctctttctgatgctcatcaac
gtggaccgctatgcggccatcgtgcacccgctgagactgcgccacctacggcggccccgt
gtggcacggcggctctgcctgggcgtgtgggctctcatcctgctgttcgctgtgcccgcc
gcccgcgtgcacagcccgtcccactgcacgtacaagaacatcactgtgcgcctgtgcttc
gagagcttcagcgatgaactgtggaagggcaggctgctgccgctcctgctgctggccgag
atactaggctttctgctgcccctggcggctgtcgtctattcgtctggcagagtcttctgg
acactggcgaggcccgacgccactcagagccaacggcgacggaagaccgtgcgcctcctg
ctggccaatctcatcatcttcctgctgtgcttcgtgccctataactccacgctggctgta
tatgggttgctacgggccaacttggtgaagaacagtattcaggaccgcgatcaggtgcgc
ggggtgctgatgataatggtgctgctggccggcgccaactgcgtgctggatccactggtt
tactacttcagtgccgagggtttccgtaacacccttcgcaacctgggcgccccgctgaat
accaggcctttggctaccaatggggctgcaggcgtgctcaccgaactaccctcagaaagc
acccaaaacactgggcaggatgccacaagtcaggttctactccagcctgccactctgggt
acacccccggacaactgctcccaggattcggctctctga

KEGG   Mus musculus (mouse): 53978Help
Entry
53978             CDS       T01002                                 

Gene name
Lpar2, Edg4, IPA2, LPA2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    53978 (Lpar2)
   04072 Phospholipase D signaling pathway
    53978 (Lpar2)
   04151 PI3K-Akt signaling pathway
    53978 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53978 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    53978 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    53978 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    53978 (Lpar2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    53978 (Lpar2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 53978
NCBI-ProteinID: NP_064412
MGI: 1858422
Ensembl: ENSMUSG00000031861
UniProt: Q6P290
LinkDB All DBs
Position
8 B3.3; 8 33.91 cM
AA seq 348 aa AA seqDB search
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVP
LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR
RTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggccagtgctactacaacgagaccatcggctttttctataataacagcggcaaggag
ctcagccttcactggcgccccaaagatgtggtggtggtggccctggggctgacagtcagt
gtgctggtattgctgaccaatctgctggttattgcagccatcgcctccaaccgacgcttc
caccagcccatatactacctgcttggcaacttggctgcggctgacctcttcgctggcatg
gcctacctcttcctcatgttccatactggcccacgcactgccaggctctccatcaaaggc
tggttcctgcgacagggcctgctggacaccagcctcacggcgtcagtggccacactgctg
gccatcgctgtggaacggcaccgcagtgtgatggcggtacagctacacagccgcctgccc
cggggccgtgtggtcacactcatcgtgggtgtgtgggcggctgcactgggtctggggttg
ctacctgcacacttctggcactgcctctgtgacttggacagttgctcacgcatggtgccc
ctgttcagccgctcctacttggctgcgtgggccctatccagcctgcttgtcttcctactc
atggtagctgtctacacacgaattttcttctatgtgcgtagacgggtggaacgcatggcg
gagcacgtcagctgccatccccgctaccgagagaccacactcagcctagtcaagacggtt
gtcatcattctgggggcatttgtggtgtgctggacaccgggccaggtggtgctgctcctg
gatggcctggactgtaagtcctgcaacgttctggctgtggagaagtacttcctgctcctg
gctgaggccaactcactggtcaatgcagtggtatattcctgccgagatgctgagatgcgc
cgcaccttccgccgccttctctgctgcatgtgtctccgctggtccagccacaagtctgcc
cgttactcagcttctgcccagacgggtgccagcacgcggatcatgcttcctgagaatggc
cgcccactgatggactccaccctttaa

KEGG   Mus musculus (mouse): 65086Help
Entry
65086             CDS       T01002                                 

Gene name
Lpar3, Edg7, lpA3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    65086 (Lpar3)
   04072 Phospholipase D signaling pathway
    65086 (Lpar3)
   04151 PI3K-Akt signaling pathway
    65086 (Lpar3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65086 (Lpar3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    65086 (Lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    65086 (Lpar3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    65086 (Lpar3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 65086
NCBI-ProteinID: NP_075359
MGI: 1929469
Ensembl: ENSMUSG00000036832
Vega: OTTMUSG00000055329
UniProt: Q9EQ31 Q544B4
LinkDB All DBs
Position
3 H2; 3 71.03 cM
AA seq 354 aa AA seqDB search
MNECHYDKRMDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDTSLTASLANL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLIFWTVSNLLAFFIMVAVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDM
YNTMRKMICCALQDSNTERRPSRNPSTIHSRSETGSQYLEDSISQGPVCNKNGS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtgtcactatgacaagcgcatggactttttctacaacaggagcaacacagac
acagcggacgagtggacagggacaaagcttgtgatcgtcctgtgcgtggggacgttcttc
tgcctctttatatttttttctaactccctggtcattgctgcggtgatcacaaaccggaag
ttccactttcccttctactacctgctggctaacttagctgctgcggatttcttcgccgga
atcgcttacgtgttcctgatgtttaacactggcccggtgtcgaaaacgttgaccgtcaac
cgctggttcctccgccaggggctcctagacaccagcctgactgcctccctggccaatttg
ctggttattgctgtggaaagacacatgtccatcatgaggatgagagtccacagcaacttg
accaaaaagcgggtgacgctgctcattctgctggtgtgggccatcgccatcttcatgggg
gccgtccccacgctgggatggaattgcctctgcaacatctcggcctgctcttctctggct
cccatttacagtaggagttacctcattttctggactgtgtccaacctcctggccttcttc
atcatggtggcggtatacgtacgcatctacatgtatgttaaaaggaaaaccaacgtctta
tctccacacaccagtggctccatcagccgccggagggctcccatgaagctaatgaagaca
gtgatgaccgtcttaggcgccttcgtggtgtgctggaccccgggtctggtggttctgctg
ctggacggcctgaactgcaagcagtgtaacgtgcaacacgtgaagcgctggttcctgctg
ctcgcactgctcaactccgtcatgaaccccatcatctactcgtacaaggacgaggacatg
tacaacaccatgcggaagatgatctgctgtgccctgcaggacagcaataccgagaggcgc
ccctcccgcaacccctccaccatccacagcaggagcgagacgggcagccagtacctggag
gacagcatcagccagggcccggtgtgcaataaaaacggctcctaa

KEGG   Mus musculus (mouse): 67168Help
Entry
67168             CDS       T01002                                 

Gene name
Lpar6, 2610302I02Rik, P2ry5, P2y5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    67168 (Lpar6)
   04151 PI3K-Akt signaling pathway
    67168 (Lpar6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    67168 (Lpar6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67168 (Lpar6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    67168 (Lpar6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    67168 (Lpar6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx MscS_TM
Motif
Other DBs
NCBI-GeneID: 67168
NCBI-ProteinID: NP_780325
MGI: 1914418
Ensembl: ENSMUSG00000033446
Vega: OTTMUSG00000036134
UniProt: Q8BMC0
LinkDB All DBs
Position
14; 14 D3
AA seq 344 aa AA seqDB search
MVSSNGSQCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCF
CFVPYNINLILYSLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctccaatggctcccagtgcccttatgacgactcctttaagtacactctgtac
gggtgcatgttcagcatggtcttcgtgcttgggctgatatccaactgtgttgcgatatac
attttcatctgtgccctcaaagtgagaaatgaaactacaacgtacatgattaacctggca
atgtcagatttacttttcgtctttactttgccatttcggattttttactttgcaacacgg
aattggccatttggagatctactctgtaagatttcagtaatgctgttttacaccaatatg
tatggaagcattctgttcttaacctgtatcagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactttaagaacgaaacgaaatgcaaagatcgtttgcattgctgtg
tggttcacagtgatgggaggaagtgcgcctgcagttttctttcagtcgacccactctcag
gggaacaatacctcagaagcctgctttgagaactttccagcggccacatggaaaacttat
ctctccaggattgtgattttcattgaaatagtgggcttttttatccctctcattttgaac
gtaacttgttctagtatggtgctaagaactttaaataaacctgttacattaagtagaagc
aaaatgaacaaaactaaggttttaaaaatgatttttgtccacttggtcatcttctgtttc
tgttttgtgccctacaacatcaacctcattttgtactcgctcatgaggacacagaccttt
gttaactgctctgtggtggcggcagtgaggaccatgtacccgatcactctctgcatcgct
gtttccaactgctgctttgaccctattgtttactacttcacctcagacacaattcagaac
tcaataaaaatgaaaaactggtcggttagaagaagtgactccaggttctctgaagttcag
ggcactgagaattttatccaacacaacctacagaccttaaaaaataagatatttgataat
gaatctgcaatataa

KEGG   Mus musculus (mouse): 78134Help
Entry
78134             CDS       T01002                                 

Gene name
Lpar4, 5730485F04Rik, Gpr23, LPA4, p2y9
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    78134 (Lpar4)
   04072 Phospholipase D signaling pathway
    78134 (Lpar4)
   04151 PI3K-Akt signaling pathway
    78134 (Lpar4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    78134 (Lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    78134 (Lpar4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78134 (Lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    78134 (Lpar4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    78134 (Lpar4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 78134
NCBI-ProteinID: NP_780480
MGI: 1925384
Ensembl: ENSMUSG00000049929
Vega: OTTMUSG00000018372
UniProt: Q8BLG2
LinkDB All DBs
Position
X; X D
AA seq 370 aa AA seqDB search
MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS
LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacagaagatttattgacttccaattccaagatttaaattcaagtctcagaccc
aggttgggaaatgcaactgccaataatacttgcattgttgatgattccttcaagtataat
ttgaatggtgctgtctatagtgttgtattcatcctgggtctaataaccaacagtgcctcc
ctgtttgtcttctgcttccgcatgaaaatgagaagtgagacggctattttcatcaccaac
ctggccctctctgatttgctttttgtttgtaccctacctttcaaaatattttacaacttt
aatcgccactggccttttggtgacaccctctgtaagatctcagggactgcgttcctcacc
aacatctatgggagcatgctcttcctcacctgcatcagtgtggatcgtttcctagccatt
gtctatcccttccgatcgcgtaccatcaggaccaggaggaattccgccattgtgtgcgct
ggagtctggatcctagtcctcagtggtggtatttcagcttctttgttctccaccactaat
gtcaacaatgcgaccaccacttgctttgaaggcttctccaaacgtgtctggaagacatac
ctgtccaagatcactatattcattgaagttgttggattcatcattcctctgatattgaat
gtttcttgttcttctgtggtgcttagaaccctccgcaagcctgcaacattgtctcagatt
gggaccaataaaaaaaaagtgttgaagatgatcacagtgcatatggcagtgtttgtggta
tgctttgtaccatacaactccgttctctttttatatgccttggtacgctcccaagccatt
actaattgcttattggaaaggtttgcaaagatcatgtacccaattaccttgtgccttgca
actctgaattgttgctttgatccttttatctattacttcactcttgaatcctttcagaag
tccttttatatcaatacacatataaggatggagtcgctgtttaagactgagacacctctg
acccccaaaccttcccttccagctatccaagaggaagttagtgatcaaacaacaaataat
ggtggtgaattaatgctggaatccaccttctag

DBGET integrated database retrieval system