KEGG   Mus musculus (mouse): 11651Help
Entry
11651             CDS       T01002                                 

Gene name
Akt1, Akt, LTR-akt, PKB, PKB/Akt, PKBalpha, Rac
Definition
(RefSeq) thymoma viral proto-oncogene 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04973  Carbohydrate digestion and absorption
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11651 (Akt1)
   04015 Rap1 signaling pathway
    11651 (Akt1)
   04010 MAPK signaling pathway
    11651 (Akt1)
   04012 ErbB signaling pathway
    11651 (Akt1)
   04370 VEGF signaling pathway
    11651 (Akt1)
   04371 Apelin signaling pathway
    11651 (Akt1)
   04630 Jak-STAT signaling pathway
    11651 (Akt1)
   04668 TNF signaling pathway
    11651 (Akt1)
   04066 HIF-1 signaling pathway
    11651 (Akt1)
   04068 FoxO signaling pathway
    11651 (Akt1)
   04072 Phospholipase D signaling pathway
    11651 (Akt1)
   04071 Sphingolipid signaling pathway
    11651 (Akt1)
   04024 cAMP signaling pathway
    11651 (Akt1)
   04022 cGMP-PKG signaling pathway
    11651 (Akt1)
   04151 PI3K-Akt signaling pathway
    11651 (Akt1)
   04152 AMPK signaling pathway
    11651 (Akt1)
   04150 mTOR signaling pathway
    11651 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11651 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    11651 (Akt1)
   04218 Cellular senescence
    11651 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11651 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    11651 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11651 (Akt1)
   04620 Toll-like receptor signaling pathway
    11651 (Akt1)
   04625 C-type lectin receptor signaling pathway
    11651 (Akt1)
   04660 T cell receptor signaling pathway
    11651 (Akt1)
   04662 B cell receptor signaling pathway
    11651 (Akt1)
   04664 Fc epsilon RI signaling pathway
    11651 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    11651 (Akt1)
   04062 Chemokine signaling pathway
    11651 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    11651 (Akt1)
   04922 Glucagon signaling pathway
    11651 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    11651 (Akt1)
   04920 Adipocytokine signaling pathway
    11651 (Akt1)
   04915 Estrogen signaling pathway
    11651 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    11651 (Akt1)
   04917 Prolactin signaling pathway
    11651 (Akt1)
   04926 Relaxin signaling pathway
    11651 (Akt1)
   04919 Thyroid hormone signaling pathway
    11651 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11651 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    11651 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    11651 (Akt1)
   04728 Dopaminergic synapse
    11651 (Akt1)
   04722 Neurotrophin signaling pathway
    11651 (Akt1)
  09158 Development
   04380 Osteoclast differentiation
    11651 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    11651 (Akt1)
   04213 Longevity regulating pathway - multiple species
    11651 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11651 (Akt1)
   05205 Proteoglycans in cancer
    11651 (Akt1)
   05230 Central carbon metabolism in cancer
    11651 (Akt1)
   05231 Choline metabolism in cancer
    11651 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    11651 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11651 (Akt1)
   05212 Pancreatic cancer
    11651 (Akt1)
   05225 Hepatocellular carcinoma
    11651 (Akt1)
   05226 Gastric cancer
    11651 (Akt1)
   05214 Glioma
    11651 (Akt1)
   05221 Acute myeloid leukemia
    11651 (Akt1)
   05220 Chronic myeloid leukemia
    11651 (Akt1)
   05218 Melanoma
    11651 (Akt1)
   05211 Renal cell carcinoma
    11651 (Akt1)
   05215 Prostate cancer
    11651 (Akt1)
   05213 Endometrial cancer
    11651 (Akt1)
   05224 Breast cancer
    11651 (Akt1)
   05222 Small cell lung cancer
    11651 (Akt1)
   05223 Non-small cell lung cancer
    11651 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11651 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    11651 (Akt1)
   04931 Insulin resistance
    11651 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    11651 (Akt1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    11651 (Akt1)
   05152 Tuberculosis
    11651 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11651 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    11651 (Akt1)
   05162 Measles
    11651 (Akt1)
   05164 Influenza A
    11651 (Akt1)
   05161 Hepatitis B
    11651 (Akt1)
   05160 Hepatitis C
    11651 (Akt1)
   05168 Herpes simplex virus 1 infection
    11651 (Akt1)
   05163 Human cytomegalovirus infection
    11651 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    11651 (Akt1)
   05169 Epstein-Barr virus infection
    11651 (Akt1)
   05165 Human papillomavirus infection
    11651 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11651 (Akt1)
   05142 Chagas disease (American trypanosomiasis)
    11651 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    11651 (Akt1)
   01524 Platinum drug resistance
    11651 (Akt1)
   01522 Endocrine resistance
    11651 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11651 (Akt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11651 (Akt1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   11651 (Akt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11651
NCBI-ProteinID: NP_001318036
MGI: 87986
Ensembl: ENSMUSG00000001729
Vega: OTTMUSG00000020941
UniProt: P31750
LinkDB All DBs
Position
12 F1; 12 61.2 cM
AA seq 480 aa AA seqDB search
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWATAIQTVADGLKRQEEETMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtagccattgtgaaggagggctggctgcacaaacgaggggaatatattaaa
acctggcggccacgctacttcctcctcaagaacgatggcacctttattggctacaaggaa
cggcctcaggatgtggatcagcgagagtccccactcaacaacttctcagtggcacaatgc
cagctgatgaagacagagcggccaaggcccaacacctttatcatccgctgcctgcagtgg
accacagtcattgagcgcaccttccatgtggaaacgcctgaggagcgggaagaatgggcc
accgccattcagactgtggcagatggactcaagaggcaggaagaagagacgatggacttc
cgatcaggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctactgggcaagggcacc
tttgggaaggtgattctggtgaaagagaaggccacaggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgtcgccaaggatgaggttgcccacacgcttactgagaaccgt
gtcctgcagaactctaggcatcccttccttacggccctcaagtactcattccagacccac
gaccgcctctgctttgtcatggagtatgccaacgggggcgagctcttcttccacctgtct
cgagagcgtgtgttctccgaggaccgggcccgcttctatggtgcggagattgtgtctgcc
ctggactacttgcactccgagaagaacgtggtgtaccgggacctgaagctggagaacctc
atgctggacaaggacgggcacatcaagataacggacttcgggctgtgcaaggaggggatc
aaggacggtgccactatgaagacattctgcggaacgccggagtacctggcccctgaggtg
ctggaggacaacgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgtggccgcctgcccttctacaaccaggaccacgagaagctgttcgagctg
atcctcatggaggagatccgcttcccgcgcacactcggccctgaggccaagtccctgctc
tccgggctgctcaagaaggaccctacacagaggctcggtgggggctccgaggatgccaag
gagatcatgcagcaccggttctttgccaacatcgtgtggcaggatgtgtatgagaagaag
ctgagcccacctttcaagccccaggtcacctctgagactgacaccaggtatttcgatgag
gagttcacagctcagatgatcaccatcacgccgcctgatcaagatgacagcatggagtgt
gtggacagtgagcggaggccgcacttcccccagttctcctactcagccagtggcacagcc
tga

KEGG   Mus musculus (mouse): 11652Help
Entry
11652             CDS       T01002                                 

Gene name
Akt2, 2410016A19Rik, AW554154, PKB, PKBbeta
Definition
(RefSeq) thymoma viral proto-oncogene 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04973  Carbohydrate digestion and absorption
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11652 (Akt2)
   04015 Rap1 signaling pathway
    11652 (Akt2)
   04010 MAPK signaling pathway
    11652 (Akt2)
   04012 ErbB signaling pathway
    11652 (Akt2)
   04370 VEGF signaling pathway
    11652 (Akt2)
   04371 Apelin signaling pathway
    11652 (Akt2)
   04630 Jak-STAT signaling pathway
    11652 (Akt2)
   04668 TNF signaling pathway
    11652 (Akt2)
   04066 HIF-1 signaling pathway
    11652 (Akt2)
   04068 FoxO signaling pathway
    11652 (Akt2)
   04072 Phospholipase D signaling pathway
    11652 (Akt2)
   04071 Sphingolipid signaling pathway
    11652 (Akt2)
   04024 cAMP signaling pathway
    11652 (Akt2)
   04022 cGMP-PKG signaling pathway
    11652 (Akt2)
   04151 PI3K-Akt signaling pathway
    11652 (Akt2)
   04152 AMPK signaling pathway
    11652 (Akt2)
   04150 mTOR signaling pathway
    11652 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11652 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    11652 (Akt2)
   04218 Cellular senescence
    11652 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11652 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    11652 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11652 (Akt2)
   04620 Toll-like receptor signaling pathway
    11652 (Akt2)
   04625 C-type lectin receptor signaling pathway
    11652 (Akt2)
   04660 T cell receptor signaling pathway
    11652 (Akt2)
   04662 B cell receptor signaling pathway
    11652 (Akt2)
   04664 Fc epsilon RI signaling pathway
    11652 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    11652 (Akt2)
   04062 Chemokine signaling pathway
    11652 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    11652 (Akt2)
   04922 Glucagon signaling pathway
    11652 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    11652 (Akt2)
   04920 Adipocytokine signaling pathway
    11652 (Akt2)
   04915 Estrogen signaling pathway
    11652 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    11652 (Akt2)
   04917 Prolactin signaling pathway
    11652 (Akt2)
   04926 Relaxin signaling pathway
    11652 (Akt2)
   04919 Thyroid hormone signaling pathway
    11652 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11652 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    11652 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    11652 (Akt2)
   04728 Dopaminergic synapse
    11652 (Akt2)
   04722 Neurotrophin signaling pathway
    11652 (Akt2)
  09158 Development
   04380 Osteoclast differentiation
    11652 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    11652 (Akt2)
   04213 Longevity regulating pathway - multiple species
    11652 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11652 (Akt2)
   05205 Proteoglycans in cancer
    11652 (Akt2)
   05230 Central carbon metabolism in cancer
    11652 (Akt2)
   05231 Choline metabolism in cancer
    11652 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    11652 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11652 (Akt2)
   05212 Pancreatic cancer
    11652 (Akt2)
   05225 Hepatocellular carcinoma
    11652 (Akt2)
   05226 Gastric cancer
    11652 (Akt2)
   05214 Glioma
    11652 (Akt2)
   05221 Acute myeloid leukemia
    11652 (Akt2)
   05220 Chronic myeloid leukemia
    11652 (Akt2)
   05218 Melanoma
    11652 (Akt2)
   05211 Renal cell carcinoma
    11652 (Akt2)
   05215 Prostate cancer
    11652 (Akt2)
   05213 Endometrial cancer
    11652 (Akt2)
   05224 Breast cancer
    11652 (Akt2)
   05222 Small cell lung cancer
    11652 (Akt2)
   05223 Non-small cell lung cancer
    11652 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11652 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    11652 (Akt2)
   04931 Insulin resistance
    11652 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    11652 (Akt2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    11652 (Akt2)
   05152 Tuberculosis
    11652 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11652 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    11652 (Akt2)
   05162 Measles
    11652 (Akt2)
   05164 Influenza A
    11652 (Akt2)
   05161 Hepatitis B
    11652 (Akt2)
   05160 Hepatitis C
    11652 (Akt2)
   05168 Herpes simplex virus 1 infection
    11652 (Akt2)
   05163 Human cytomegalovirus infection
    11652 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    11652 (Akt2)
   05169 Epstein-Barr virus infection
    11652 (Akt2)
   05165 Human papillomavirus infection
    11652 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11652 (Akt2)
   05142 Chagas disease (American trypanosomiasis)
    11652 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    11652 (Akt2)
   01524 Platinum drug resistance
    11652 (Akt2)
   01522 Endocrine resistance
    11652 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11652 (Akt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11652 (Akt2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   11652 (Akt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 11652
NCBI-ProteinID: NP_001103678
MGI: 104874
Ensembl: ENSMUSG00000004056
Vega: OTTMUSG00000016504
UniProt: Q60823 Q3TY95 Q8CE74
LinkDB All DBs
Position
7 A3; 7 15.94 cM
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDAM
DYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLDPLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtatctgtcatcaaagaaggctggctccacaaacgtggtgaatacatcaag
acctggaggccacggtacttccttctgaagagtgatggatctttcattgggtataaggag
aggcccgaggcccctgaccagaccttaccccccctgaacaatttctctgtagcagaatgc
cagctgatgaagactgagaggccacgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtagactctccagatgagagggaagagtggatg
cgggctatccagatggtcgccaacagtctgaagcagcggggcccaggtgaggacgccatg
gattacaagtgtggctcccccagtgactcttccacatctgagatgatggaggtagctgtc
aacaaggcacgggccaaagtgaccatgaatgacttcgattatctcaaactcctcggcaag
ggcaccttcggcaaggtcattctggttcgagagaaggccactggccgctattatgccatg
aagatcctgcgcaaggaggtcatcattgcaaaggatgaagtcgcccacacagtcacagag
agccgggttctgcagaataccaggcaccccttccttacagccctcaagtatgccttccag
acccatgaccgcctatgctttgtgatggagtatgccaacgggggtgagctgtttttccac
ctctctcgggagcgagtcttcacggaggatcgggcgcgcttttatggagcagagattgtg
tcagctctggagtatttgcactcgagagatgtggtgtaccgtgacatcaagctggaaaac
cttatgttggacaaagatggccacatcaagatcactgactttggcttgtgcaaagagggc
atcagtgatggagccaccatgaaaaccttctgtggtaccccggagtacttggcgcctgag
gtgctagaggacaatgactatgggcgagcagtggactggtgggggctgggtgtggtcatg
tatgagatgatgtgtggccgcctgccattctacaaccaggaccacgagcgcctctttgag
ctcattcttatggaggagatccgcttcccgcgcacactcgggccagaggccaagtccctg
ctggctggactgctgaagaaggacccaaagcagaggctcggcggaggtcccagtgatgcg
aaggaggtcatggagcatagattcttcctcagcatcaactggcaggacgtggtacagaaa
aagctcctgccacccttcaaacctcaggtcacttcagaagtggacacaaggtactttgat
gacgagttcaccgcccagtccatcacaatcacacccccagaccgatatgacagcctggac
ccgctggaactggaccagcggacgcacttcccccagttctcctactcagccagcatccga
gagtga

KEGG   Mus musculus (mouse): 23797Help
Entry
23797             CDS       T01002                                 

Gene name
Akt3, AI851531, D930002M15Rik, Nmf350
Definition
(RefSeq) thymoma viral proto-oncogene 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04973  Carbohydrate digestion and absorption
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    23797 (Akt3)
   04015 Rap1 signaling pathway
    23797 (Akt3)
   04010 MAPK signaling pathway
    23797 (Akt3)
   04012 ErbB signaling pathway
    23797 (Akt3)
   04370 VEGF signaling pathway
    23797 (Akt3)
   04371 Apelin signaling pathway
    23797 (Akt3)
   04630 Jak-STAT signaling pathway
    23797 (Akt3)
   04668 TNF signaling pathway
    23797 (Akt3)
   04066 HIF-1 signaling pathway
    23797 (Akt3)
   04068 FoxO signaling pathway
    23797 (Akt3)
   04072 Phospholipase D signaling pathway
    23797 (Akt3)
   04071 Sphingolipid signaling pathway
    23797 (Akt3)
   04024 cAMP signaling pathway
    23797 (Akt3)
   04022 cGMP-PKG signaling pathway
    23797 (Akt3)
   04151 PI3K-Akt signaling pathway
    23797 (Akt3)
   04152 AMPK signaling pathway
    23797 (Akt3)
   04150 mTOR signaling pathway
    23797 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23797 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    23797 (Akt3)
   04218 Cellular senescence
    23797 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23797 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    23797 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    23797 (Akt3)
   04620 Toll-like receptor signaling pathway
    23797 (Akt3)
   04625 C-type lectin receptor signaling pathway
    23797 (Akt3)
   04660 T cell receptor signaling pathway
    23797 (Akt3)
   04662 B cell receptor signaling pathway
    23797 (Akt3)
   04664 Fc epsilon RI signaling pathway
    23797 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    23797 (Akt3)
   04062 Chemokine signaling pathway
    23797 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    23797 (Akt3)
   04922 Glucagon signaling pathway
    23797 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    23797 (Akt3)
   04920 Adipocytokine signaling pathway
    23797 (Akt3)
   04915 Estrogen signaling pathway
    23797 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    23797 (Akt3)
   04917 Prolactin signaling pathway
    23797 (Akt3)
   04926 Relaxin signaling pathway
    23797 (Akt3)
   04919 Thyroid hormone signaling pathway
    23797 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23797 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    23797 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    23797 (Akt3)
   04728 Dopaminergic synapse
    23797 (Akt3)
   04722 Neurotrophin signaling pathway
    23797 (Akt3)
  09158 Development
   04380 Osteoclast differentiation
    23797 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    23797 (Akt3)
   04213 Longevity regulating pathway - multiple species
    23797 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23797 (Akt3)
   05205 Proteoglycans in cancer
    23797 (Akt3)
   05230 Central carbon metabolism in cancer
    23797 (Akt3)
   05231 Choline metabolism in cancer
    23797 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    23797 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    23797 (Akt3)
   05212 Pancreatic cancer
    23797 (Akt3)
   05225 Hepatocellular carcinoma
    23797 (Akt3)
   05226 Gastric cancer
    23797 (Akt3)
   05214 Glioma
    23797 (Akt3)
   05221 Acute myeloid leukemia
    23797 (Akt3)
   05220 Chronic myeloid leukemia
    23797 (Akt3)
   05218 Melanoma
    23797 (Akt3)
   05211 Renal cell carcinoma
    23797 (Akt3)
   05215 Prostate cancer
    23797 (Akt3)
   05213 Endometrial cancer
    23797 (Akt3)
   05224 Breast cancer
    23797 (Akt3)
   05222 Small cell lung cancer
    23797 (Akt3)
   05223 Non-small cell lung cancer
    23797 (Akt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    23797 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    23797 (Akt3)
   04931 Insulin resistance
    23797 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    23797 (Akt3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    23797 (Akt3)
   05152 Tuberculosis
    23797 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    23797 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    23797 (Akt3)
   05162 Measles
    23797 (Akt3)
   05164 Influenza A
    23797 (Akt3)
   05161 Hepatitis B
    23797 (Akt3)
   05160 Hepatitis C
    23797 (Akt3)
   05168 Herpes simplex virus 1 infection
    23797 (Akt3)
   05163 Human cytomegalovirus infection
    23797 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    23797 (Akt3)
   05169 Epstein-Barr virus infection
    23797 (Akt3)
   05165 Human papillomavirus infection
    23797 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23797 (Akt3)
   05142 Chagas disease (American trypanosomiasis)
    23797 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    23797 (Akt3)
   01524 Platinum drug resistance
    23797 (Akt3)
   01522 Endocrine resistance
    23797 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    23797 (Akt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23797 (Akt3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   23797 (Akt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 23797
NCBI-ProteinID: NP_035915
MGI: 1345147
Ensembl: ENSMUSG00000019699
Vega: OTTMUSG00000020798
UniProt: Q9WUA6 Q8C6X4
LinkDB All DBs
Position
1; 1 H4
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggctataaggag
aaacctcaagatgtggacttaccttatcccctcaacaacttctcagtggcaaaatgtcag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatacaccagaggaaagagaagagtggacggaa
gctatccaagccgtagccgaccgattgcagaggcaagaggaggagaggatgaattgtagc
ccaacctcacagattgataatataggagaagaagagatggatgcgtctacaacccatcat
aaaagaaagacgatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtacta
aagaacaccagacatccatttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggcggagagctgtttttccatttgtcgagagag
cgagtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctagat
aaggatggccatataaaaattacggattttgggctttgcaaagaagggatcacagatgca
gctaccatgaagacattctgtggcacaccagagtacctggcaccagaggtattagaagat
aatgactatggccgagccgtggactggtggggcttaggtgttgtcatgtatgaaatgatg
tgtggaaggttgcctttctacaaccaggatcatgagaaactctttgaattaatactaatg
gaagacattaaattcccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggagggccagatgatgcaaaagaaatcatg
aggcatagttttttttctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgaaacagacacccgatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgacgacgacggcatggacggcatg
gacaacgagcggcggccacacttccctcagttctcctactctgcaagcggacgggaataa

DBGET integrated database retrieval system