KEGG   Mus musculus (mouse): 11669Help
Entry
11669             CDS       T01002                                 

Gene name
Aldh2, AHD-M1, ALDH-E2, ALDHI, Ahd-5, Ahd5
Definition
(RefSeq) aldehyde dehydrogenase 2, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11669 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    11669 (Aldh2)
   00620 Pyruvate metabolism
    11669 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11669 (Aldh2)
   00561 Glycerolipid metabolism
    11669 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11669 (Aldh2)
   00310 Lysine degradation
    11669 (Aldh2)
   00330 Arginine and proline metabolism
    11669 (Aldh2)
   00340 Histidine metabolism
    11669 (Aldh2)
   00380 Tryptophan metabolism
    11669 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11669 (Aldh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     11669 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 11669
NCBI-ProteinID: NP_033786
MGI: 99600
Ensembl: ENSMUSG00000029455
Vega: OTTMUSG00000023440
UniProt: P47738 Q544B1
LinkDB All DBs
Position
5; 5 F
AA seq 519 aa AA seqDB search
MLRAALTTVRRGPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgcactcaccactgtccgccgcggaccgcgcctgagccgcctgttgtcc
gccgccgccaccagcgcggtgccagcccccaaccatcagcctgaggtcttctgcaaccag
atcttcattaacaatgagtggcacgacgccgtcagcaggaaaacatttcccaccgtcaac
ccttccacaggggaggtcatctgccaggtggccgaagggaacaaggaggacgtagacaag
gcagtgaaggctgctcgtgcagccttccagctgggctcgccctggcgccgcatggatgca
tctgaccggggccggctgttgtaccgattggcggatctcattgaacgggaccggacctac
ctagcggccttggagaccctggacaacggcaagccttatgtcatctcgtacctggtggat
ttggacatggtcctgaaatgtctccgctattacgctggctgggctgacaagtaccatggg
aaaaccattcccatcgacggcgacttcttcagctatacccgccatgagcctgtgggcgtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcatggaaactgggccca
gccctggcaaccgggaacgtggtggtgatgaaggtggccgagcagacaccgctcaccgcg
ctctacgtggccaacttgatcaaggaggcaggctttccccctggcgtggtcaatatcgtt
cccggattcggccctaccgccggggctgccatcgcatcccatgagggtgtggacaaagtg
gcgttcacaggctccacggaggttggtcacctaatccaggtggccgccgggagcagcaac
ctcaagagagtaaccctggagctggggggaaagagtcccaacatcatcatgtccgacgct
gacatggactgggctgtggagcaggcccactttgccctgttcttcaaccagggccagtgc
tgctgcgcaggctcccggaccttcgtgcaggagaatgtgtatgacgaattcgtggaacgc
agcgtggctcgggccaagtctcgggtggtggggaaccccttcgacagccggacggagcag
gggcctcaggtggatgaaactcagtttaagaagatcctcggctacatcaaatcgggacaa
caagaaggggcgaagctgctgtgtggtgggggcgctgccgcggaccgtggctactttatc
cagcccaccgtgttcggggacgtaaaagacggcatgaccattgccaaggaggagatcttt
ggaccagtgatgcaaatcctcaaattcaagaccatcgaggaggttgtggggcgggccaat
gattctaagtatgggctggcagccgccgtcttcacaaaggacctggataaagccaattac
ctgtcccaagctctgcaggctggcactgtgtggatcaactgctacgatgtgtttggggcc
cagtctccatttgggggctataagatgtcagggagtggcagggagctgggcgagtatggc
ctgcaggcgtacacagaagtgaagacggttactgtcaaagtgccacagaagaactcgtaa

DBGET integrated database retrieval system