KEGG   Mus musculus (mouse): 11682Help
Entry
11682             CDS       T01002                                 

Gene name
Alk, CD246, Tcrz
Definition
(RefSeq) anaplastic lymphoma kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05223  Non-small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11682 (Alk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    11682 (Alk)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    11682 (Alk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11682 (Alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11682 (Alk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     11682 (Alk)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   11682 (Alk)
CD molecules [BR:mmu04090]
 Proteins
  11682 (Alk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 11682
NCBI-ProteinID: NP_031465
MGI: 103305
Ensembl: ENSMUSG00000055471
UniProt: P97793
LinkDB All DBs
Position
17 E1.3; 17 43.77 cM
AA seq 1621 aa AA seqDB search
MGAAGFLWLLPPLLLAAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPQPRSPSEPEAGGLEARGSLALDCEPLLRLLGPLPGISWADGASSPS
PEAGPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEVAAVGILQFNLSELFS
WWILHGEGRLRIRLMPEKKASEVGREGRLSSAIRASQPRLLFQIFGTGHSSMESPSETPS
PPGTFMWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNHGNQSWSWRHVPSE
EASRMNLLDGPEAEHSQEMPRGSFLLLNTSADSKHTILSPWMRSSSDHCTLAVSVHRHLQ
PSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYISSGNRSLSA
VDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDEGQLCSKLPA
GFYCNFENGFCGWTQSPLSPHMPRWQVRTLRDAHSQGHQGRALLLSTTDILASEGATVTS
ATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVATDEGLSLWQHT
VLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKMSLNSVPKSRNLF
EKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGS
EGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTLYILVG
QQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV
PLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSL
LEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGV
SFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAD
DGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSP
EYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVS
GMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILL
ELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCL
LTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFG
VLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNF
AIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQPAKHEEA
SAAPQPAALTAPGPSVKKPPGAGAGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHK
GPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAA
LLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTMLKSKNKVTQPG
P
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgggttcctgtggctgctgcctccactgcttttggcagcagcctcgtac
tccggagctgcaaccgatcagcgcgcgggttccccagcctcagggcctcctctgcagccc
cgggagccgctcagttattcgcgcctgcagaggaagagtctggcagtggacttcgttgta
ccctcgctcttccgcgtctatgcccgagacctgctgctaccgcagccacggtccccctcg
gagcccgaggctggcgggctggaggcgcggggatcactggccctggattgtgagcctctg
ctcaggctgctggggccactgcctggaatctcctgggcagatggagccagttctcctagt
cccgaggcgggtccgacgctgtccagggtgctgaagggaggctcggtgcgcaagctcagg
cgtgccaaacagctggtgctggagctgggcgaggagacgattcttgaaggctgtattggt
cccccagaggaggtagcggctgtggggatactccagttcaacctcagcgagctgttcagc
tggtggattctccacggcgaagggaggctgaggatccgcctgatgcctgagaagaaggca
tcggaagtgggcagggagggaaggctatccagtgcgatccgagcctcccagccccgcctt
ctcttccagatcttcgggacgggacacagctccatggagtcaccctcagaaacgccttct
cctcctggtaccttcatgtggaatctgacctggacgatgaaagactccttccctttcctt
tcccaccgcagtcgatatggtctggagtgcagctttgacttcccctgtgagctggaatat
tctcctcccctgcacaaccacgggaatcagagctggtcctggcgccatgtgccctccgag
gaggcctcgaggatgaacttgctggatgggccagaggcagagcattctcaagagatgccc
agaggctccttcctcctcctgaacacctctgcagattccaagcataccattctgagccca
tggatgaggagcagtagtgatcactgcacactggctgtctccgtgcacagacatctacag
ccttcggggagatatgttgcccagctcctaccccacaacgaagctggaagagagattctt
ttggtgcccaccccagggaagcatggctggacagtgctgcaggggagagtcgggcgccca
gcaaacccatttcgagtggctctggaatacatctccagtggcaaccggagcttgtcggcg
gtggatttctttgccctgaagaactgcagtgaagggacatccccaggctccaagatggca
ttgcagagttccttcacttgttggaatgggaccgtcctccagctcgggcaagcctgtgat
ttccaccaggactgtgcccaaggagaagatgagggccagctgtgcagtaaacttcctgct
ggattttactgtaactttgaaaatggcttctgtggctggacccaaagtccactctcaccc
catatgccccggtggcaagtgaggaccctaagagatgcccattcccagggccaccaaggc
cgtgccctgttgctcagcaccactgacatcctcgcttctgaaggtgcaacagtgaccagt
gccaccttccctgcaccaatgaaaaattctccttgtgagctccgcatgtcctggctcatc
cgcggggttttgagaggaaacgtatctctggtgctggtggagaacaaaaccggaaaggag
caaagccggactgtctggcatgtcgccactgacgaaggcttaagcctgtggcagcataca
gtgctgtccctcctcgatgtgactgacaggttctggctgcagatagtcacatggtggggt
ccaggatccagggcaaccgtgggatttgacaacatttccatcagcctcgactgctacctt
accatcagtggagaggagaaaatgtccctgaattcagtacccaaatctagaaatctgttt
gagaaaaacccaaacaaggagtcaaaatcctgggcaaacatatcaggaccaactcccatc
ttcgaccctacagttcactggctgttcaccacgtgtggggccagtggacctcatggcccc
acccaggcacagtgcaacaacgcctaccagaattccaacttgagcgtggtggtgggaagt
gaagggcccttgaagggagtccagatttggaaagtgccagctactgacacctacagtatc
tcgggctacggagcagctggcgggaaaggtgggaaaaacaccatgatgcggtcccatggc
gtgtctgtcctgggcatcttcaatctggagaaaggtgacacactctacatccttgtcggt
cagcaaggggaggatgcctgtcccagggcaaaccaactaatccagaaagtctgtgtgggt
gagaacaatgtcatagaagaagagatccgagtgaacagaagcgtgcacgagtgggcagga
ggaggaggaggtgggggtggagccacctacgtgtttaagatgaaagatggcgtgcctgta
cccctgatcattgcagctggtggtggtggcagggcctatggggccaagacagaaacgttc
cacccagagagactggagagtaactcctcggttctagggctgaacggcaattccggagcc
gcaggtggtggaggcggctggaatgataacacttccttgctctgggccggaaagtctttg
ctggagggtgccgccggaggacattcctgcccccaggccatgaagaagtgggggtgggag
acaagagggggtttcggagggggtggaggggggtgctcctcaggtggaggaggcggagga
tatataggtggcaacgcagcatcaaacaatgaccccgaaatggatggggaagatggggtt
tccttcatcagtccattgggtatcctgtacaccccggccttaaaagtgatggagggccac
ggggaagtgaatatcaagcattatctaaactgcagtcactgcgaggtagacgaatgtcac
atggaccccgagagccacaaagtcatctgcttctgtgatcatgggaccgtgctggctgat
gatggtgtctcctgcattgtgtcacccaccccggagccccacctgccgctctcattgatc
ctctccgtcgtgacctctgccctggtggctgcccttgttctggcattctccggcatcatg
attgtgtaccgtcggaagcaccaggagttgcaggctatgcagatggaactgcagagcccc
gagtataagctgagcaagctacggacctcgaccatcatgaccgactacaaccccaactac
tgcttcgctggcaagacttcctccatcagtgacctgaaagaagtgccacggaaaaacatc
acactcatccggggcctaggccatggcgcatttggggaggtgtatgaaggccaggtgtct
ggaatgcccaatgacccaagccctctacaagtggctgtaaagacgctgccagaagtgtgt
tcagaacaagatgagctggactttctcatggaagctctgatcatcagcaaattcaaccac
cagaatattgttcgctgcatcggggtgagtctacaagccctgccccgcttcatcctgctg
gaactcatggctggcggagacctcaagtccttcctcagggagacacgccctcgcccgaac
caacccacctccctggccatgctggaccttctgcatgtggctcgggacattgcctgtggc
tgtcagtacctagaggagaatcactttatccaccgggatattgctgctagaaactgtctg
ttgacctgcccaggagctggaagaatagcaaagattggagactttgggatggcccgagat
atctacagggccagctactaccgaaagggaggctgcgccatgctgccggtcaagtggatg
ccccctgaagccttcatggaagggatatttacctctaaaacagacacatggtcttttgga
gtgttgctatgggaaatattttctcttggatatatgccgtaccccagcaagagcaaccag
gaagttctggagtttgtcaccagcggaggacggatggacccgcctaagaactgccccggg
cctgtataccggataatgacgcagtgctggcagcatcagcctgaagacagacccaacttc
gccatcattttggagaggatcgaatactgcacccaggaccccgatgtgatcaacacagct
ctgcccatcgaatacggtccagtagtagaagaggaggagaaagtgcccatgcgccccaaa
gaccccgaggggatgccacctttgctggtgtctccccagcctgcgaagcacgaggaggcg
tccgcagctccccagcccgcagccctgacggcaccaggcccatcggtgaagaagcccccg
ggtgcgggtgcgggcgcgggcgcgggtgcgggtgccggcccggtgccccgaggtgcggcc
gatcggggccacgtgaacatggctttctctcagcccaaccctcccccggagctgcacaaa
ggcccgggatccagaaacaagccgaccagcctgtggaaccccacctacggctcgtggttc
accgagaagcctgccaaaaagacccatcctccgccaggcgccgagccgcaggcgcgggca
ggagcggccgagggtggctggaccgggccgggcgcggggccccgcagagccgaggcagcg
ctgctgctagagccatcggcgctgagcgccaccatgaaggaggtgccgctgttcaggctg
cgccacttcccctgcggcaatgtcaactatggttaccagcaacagggtctccccttggaa
gccacagccgcgccaggggacaccatgctgaaaagcaagaataaggtcacccagccgggg
ccctga

KEGG   Mus musculus (mouse): 78798Help
Entry
78798             CDS       T01002                                 

Gene name
Eml4, 4930443C24Rik, AI644019
Definition
(RefSeq) echinoderm microtubule associated protein like 4
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05223  Non-small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78798 (Eml4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    78798 (Eml4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    78798 (Eml4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    78798 (Eml4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     78798 (Eml4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HELP WD40 ANAPC4_WD40 SlyX Ribosomal_S7 Sugarporin_N
Motif
Other DBs
NCBI-GeneID: 78798
NCBI-ProteinID: NP_001273496
MGI: 1926048
Ensembl: ENSMUSG00000032624
UniProt: Q3UMY5 A7ISP9 A0A3Q4EHV9
LinkDB All DBs
Position
17; 17 E4
AA seq 941 aa AA seqDB search
MDCNRSKMNRVSSDPVAIPDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVL
RRLAISEDHVASVKKSMPSKGQPSLREAISMSCITNGSGISRKQNHTSSVSIARKETLSS
AAKSIKRPPTAEKSHNSWENSDDSRNKLMKTVSTSKLISKVIKNADKHKDVIVNQAKMST
REKNSQEGEYIKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANV
YLLPTGEIVYFIASVVVLFNYEERTQRHYLGHTDCVRCLAVHPDKIRIATGQIAGVDKDG
RPLQPHVRVWDSVSLTTLHVIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDW
QKKSKIAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKP
KFVQCLAFLGNGDVLTGDSGGVMLIWSKTMVEPPPGKGPKGVYQINRQIKAHDGSVFTLC
QMRNGMLLTGGGKDRKIILWDHDLNLEREIEVPDQYGTIRAVAEGRAEQFLVGTSRNFIL
RGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPG
HCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHD
NFIYLYTVLENGRKYSRYGKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKL
IRNRSDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLF
QYPCSKAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPVPQNEVI
TDASVTKTPASSSETARPSNSPPLPPSLPLTGTAEEESRMGSSPTLVENSLEQIAEPSEE
QSEWGSEDLGVVIDEEPASELSETQGATELPEEERGITPLC
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggattgtaatagaagcaaaatgaacagagtatccagtgatccagtggctataccagat
gatagtatttctgctgcaagtacctctgacgttcaagaccgcctctcagctcttgagtca
cgagttcaacaacaagaagatgaaatcactgtgctaaaggcagcattggctgatgttttg
aggcgtcttgcaatctctgaagatcatgtagcctcagtgaaaaagtccatgccaagtaaa
ggccaaccaagccttcgagaagctatttctatgtcctgtataaccaatggaagtggtata
agcagaaaacagaatcataccagctctgtatcaatagcaagaaaagaaactctttcttca
gctgctaaaagcataaaacgtccaccaacagctgaaaagtcacataactcatgggaaaat
tcagatgatagtcgtaataaattaatgaaaacggtttcaacatcaaaactaatatcaaag
gttataaaaaatgcagacaaacataaagatgtcatcgtcaatcaagcaaaaatgtcaacc
cgggaaaaaaacagccaagaaggagaatatattaaaatgtttatgcgaggtcggccaatt
acaatgttcattccttcggatgttgacaactatgatgacatcagaacagaactgcctcca
gagaagctcaaactggagtgggtatacggttatcgaggaaaggactgtagagcgaatgta
tacctgcttcccacaggggagatagtttattttatcgcctcagtggtagtcctgtttaat
tatgaggagaggactcagcgacactacctgggtcatacagactgtgtgagatgccttgct
gtacatcctgacaagattagaattgcaactggacagatagccggagtagacaaagatgga
aggcctctgcaaccccatgtcagggtgtgggattcagtaagtcttaccacactgcatgtt
attggacttggaacttttgagcgtggagtaggatgcctggatttttcaaaagcagattca
ggtgttcatttatgcgttattgatgactccaatgagcacatgcttactgtatgggactgg
cagaaaaaatcaaaaatcgcagaaataaagacaacaaacgaagttgttttggctgtagaa
ttccacccaacagatgcaaatacaataataacatgtggtaaatctcatatttttttctgg
acctggagtggcaactcactaacaagaaaacagggaatttttgggaaatatgaaaaacca
aaattcgttcagtgtttggcattcttggggaatggagatgttctcactggagactcgggt
ggagtcatgctgatctggagcaaaacgatggtagagcccccgcccgggaaaggacctaaa
ggtgtgtatcagatcaacagacaaatcaaagctcatgatggcagtgtgtttacactttgt
cagatgagaaatgggatgctattaactggaggcggaaaagacagaaaaataattttgtgg
gatcatgatctgaaccttgaaagagaaatagaggttcctgatcagtatggcaccattaga
gcagttgcagagggaagggcagaacagttcttagtaggcacatcacgaaactttatttta
cggggaacgtttaatgatggcttccaaatagaagtccagggtcatacagatgaactctgg
ggccttgcaacacatcccttcaaagatttgctcttgacgtgtgctcaggacaggcaggtg
tgcatgtggaactcagtggagcacaggctggagtggaccaggcttgtggacgaaccagga
cactgtgcagactttcatccaagcggtacagtggtagccattggaacgcactcaggcagg
tggtttgttctggatgcagaaacaagagatctggtgtcaatccacacggatggcaatgag
cagctgtctgtgatgcgctactcagtagatggcactcttctggctgtgggctctcatgac
aactttatttacctctacacagtcttagaaaacggaagaaaatacagcagatatggaaag
tgcactggacattctagctacatcacacaccttgactggtccccagacaataagcatata
atgtctaactcgggtgactacgagatactgtactgggacattgaaaatggctgcaaacta
atcaggaaccgatcagattgcaaggacatcgattggacaacatatacctgtgtgctaggc
ttccaagtctttggggtgtggccggaagggtccgatggaacagacatcaacgcactggtt
cgatcccacaacagaagagtgatcgcagtggccgatgatttctgcaaagttcatctcttt
cagtacccctgctccaaagccaaggctcccagtcacaagtacagtgcccacagcagccat
gtgaccaacgtcagttttactcataatgacagtcacctaatttcaactggtgggaaggat
atgagcatcattcagtggaagcttgtggaaaagttacctgtgcctcaaaacgaggtcata
acagacgccagtgtgaccaaaacccctgcctcttcctctgaaactgccaggccgtctaac
tctcctccactgcctccttctctaccgttaactgggacggctgaagaggaaagcaggatg
ggcagctcccccacactagtggagaacagcctggagcagatcgcagagcccagcgaggag
cagagcgagtggggtagcgaagaccttggtgtggtgattgatgaagagcctgctagtgag
ttaagtgagacacagggagcaactgagctgcctgaggaggagcgaggcataacacccctg
tgctaa

DBGET integrated database retrieval system