KEGG   Mus musculus (mouse): 117149Help
Entry
117149            CDS       T01002                                 

Gene name
Tirap, AA407980, C130027E04Rik, Mal, Tlr4ap, Wyatt
Definition
(RefSeq) toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu05133  Pertussis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    117149 (Tirap)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    117149 (Tirap)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    117149 (Tirap)
  09171 Infectious disease: bacterial
   05133 Pertussis
    117149 (Tirap)
   05152 Tuberculosis
    117149 (Tirap)
  09172 Infectious disease: viral
   05161 Hepatitis B
    117149 (Tirap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 117149
NCBI-ProteinID: NP_473437
MGI: 2152213
Ensembl: ENSMUSG00000032041
Vega: OTTMUSG00000042147
UniProt: Q99JY1 Q542S6 H3BKL1
LinkDB All DBs
Position
9; 9 A4
AA seq 249 aa AA seqDB search
MVSLEACTMASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTAT
QDGLSPSSCSSPPSHSSPESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCH
SEEDLEAAQELVSYLEGSQASLRCFLQLRDAAPGGAIVSELCQALSRSHCRVLLITPGFL
RDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPELRFMYYVDGRGKDGGFYQVKEA
VIHYLETLS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttagtttggaggcctgcactatggcttcatcctcctccgtcccagcctcctccact
ccgtccaagaagcctcgagacaagatagctgactggttcaggcaggctctgttgaagaag
cccaagaagatgccgatctcccaggaaagccacctctatgatggttcacagacagccaca
caggatggtctctcaccctcgagctgcagctcacccccgagtcacagttcaccggagagc
cgtagctcaccctcgagctgcagttcaggaatgtcacctacctcgccaccaacacacgtg
gacagcagcagcagcagcagtggccgctggagcaaagactacgatgtctgcgtgtgccac
agtgaggaggacttggaggcggcccaggagctggtctcctacttggagggtagccaggcc
agtctacgctgcttcctgcagcttcgggatgcagccccgggtggcgccattgtttcggag
ctatgccaggcactgagtcgtagtcactgccgtgtgctgctcatcactccaggcttcctt
cgggacccctggtgcaagtaccagatgctgcaggccctgacggaggccccggcgtcggag
ggttgcaccatacccctgctgtccggcctgtccagagccgcctatccgccggaactccga
ttcatgtactatgtggatggcagaggcaaggacggaggcttttaccaagtcaaggaggct
gttatacactatctggagacactaagctga

DBGET integrated database retrieval system