KEGG   Mus musculus (mouse): 11783Help
Entry
11783             CDS       T01002                                 

Gene name
Apaf1, 6230400I06Rik, Apaf-1, Apaf1l, fog, mKIAA0413
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05134  Legionellosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11783 (Apaf1)
   04215 Apoptosis - multiple species
    11783 (Apaf1)
   04115 p53 signaling pathway
    11783 (Apaf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11783 (Apaf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    11783 (Apaf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11783 (Apaf1)
   05012 Parkinson disease
    11783 (Apaf1)
   05014 Amyotrophic lateral sclerosis (ALS)
    11783 (Apaf1)
   05016 Huntington disease
    11783 (Apaf1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    11783 (Apaf1)
   05152 Tuberculosis
    11783 (Apaf1)
  09172 Infectious disease: viral
   05162 Measles
    11783 (Apaf1)
   05164 Influenza A
    11783 (Apaf1)
   05161 Hepatitis B
    11783 (Apaf1)
   05160 Hepatitis C
    11783 (Apaf1)
   05168 Herpes simplex virus 1 infection
    11783 (Apaf1)
   05169 Epstein-Barr virus infection
    11783 (Apaf1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11783 (Apaf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Nup160 AAA_16 AAA_22 AAA_18
Motif
Other DBs
NCBI-GeneID: 11783
NCBI-ProteinID: NP_001036023
MGI: 1306796
Ensembl: ENSMUSG00000019979
Vega: OTTMUSG00000027822
UniProt: O88879 Q5DU30
LinkDB All DBs
Structure
PDB: 

Position
10 C2; 10 45.47 cM
AA seq 1249 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDHMISNGVLSVIEEEKVKSQATQYQRAAALIKMI
LNKDNCAYISFYNALLHEGYKDLAALLQSGLPLVSSSSGKDTDGGITSFVRTVLCEGGVP
QRPVIFVTRKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSG
GVHWVSIGKQDKSGLLMKLQNLCMRLDQEESFSQRLPLNIEEAKDRLRVLMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKHVVPVESGLGREKGLEILSLFVN
MKKEDLPAEAHSIIKECKGSPLVVSLIGALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCVLWDLETEEVEDILQEFVN
KSLLFCNRNGKSFCYYLHDLQVDFLTEKNRSQLQDLHRKMVTQFQRYYQPHTLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVAYRHILDEKDCAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLQAKQEGDTGRLYLEWINK
KTIKNLSRLVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEV
LCCAFSSDDSYIATCSADKKVKIWDSATGKLVHTYDEHSEQVNCCHFTNKSNHLLLATGS
NDFFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDELLASCSADGTLRLWDVRSANERKS
INVKRFFLSSEDPPEDVEVIVKCCSWSADGDKIIVAAKNKVLLFDIHTSGLLAEIHTGHH
STIQYCDFSPYDHLAVIALSQYCVELWNIDSRLKVADCRGHLSWVHGVMFSPDGSSFLTA
SDDQTIRVWETKKVCKNSAIVLKQEIDVVFQENETMVLAVDNIRGLQLIAGKTGQIDYLP
EAQVSCCCLSPHLEYVAFGDEDGAIKIIELPNNRVFSSGVGHKKAVRHIQFTADGKTLIS
SSEDSVIQVWNWQTGDYVFLQAHQETVKDFRLLQDSRLLSWSFDGTVKVWNVITGRIERD
FTCHQGTVLSCAISSDATKFSSTSADKTAKIWSFDLLSPLHELKGHNGCVRCSAFSLDGI
LLATGDDNGEIRIWNVSDGQLLHSCAPISVEEGTATHGGWVTDVCFSPDSKTLVSAGGYL
KWWNVATGDSSQTFYTNGTNLKKIHVSPDFRTYVTVDNLGILYILQVLE
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaggcccgcaattgtttgcttcaacatagagaagctttggaaaaggacatc
aaaacatcctacatcatggatcacatgatcagtaatggcgtcttgtcagtgatagaggag
gagaaggtcaaaagtcaggccactcaatatcaacgagcagccgctttaattaaaatgata
cttaataaagacaactgtgcctacatttcattctacaacgctctgctacacgagggctat
aaggaccttgctgcgcttctgcagagtggccttcctcttgtgtcgtcttccagtggcaag
gacacagatggtggaataacttcatttgtaaggacagtgctgtgtgaaggtggagtaccc
cagaggccggttattttcgttactagaaagaagctggttcatgcgattcagcagaagctc
tggaaactgaatggagaaccagggtgggtcaccatctatgggatggcaggctgcggcaag
tctgtgttagctgcggaagccgttcgagatcactccctcttagaaggttgcttttcaggg
ggtgtacactgggtttccattggaaaacaagacaaatctgggcttctcatgaaactgcag
aatctgtgcatgcgcttggaccaagaagagagtttctctcagaggcttccacttaatatt
gaggaggccaaagaccgcctccgtgttctgatgctgcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagataagagtgttacagattcagtaatgggtcctaagcatgttgtc
cctgtggagagtggtctagggagagagaaaggacttgagatcttgtcactttttgttaac
atgaagaaagaagatctgccagcggaggctcacagtattataaaggaatgcaaaggttct
cctcttgtagtgtctttaattggtgcgcttttacgtgattttcccaatcgctgggcatac
tacctcagacagcttcagaataagcagtttaagagaataaggaagtcttcatcttatgat
tatgaggctctagatgaagccatgtcgataagtgttgaaatgctcagagaagacatcaaa
gactattacacagacctttccatccttcagaaggacgtcaaggtacctacaaaggtgttg
tgcgttctctgggacttggaaacggaagaagttgaagacatcctgcaggagttcgttaat
aagtctctcttattctgtaatcggaatggaaagtcattttgttattatttacatgatctt
caagtagattttcttacagagaagaatcgcagtcagcttcaggatctgcacaggaagatg
gtcactcagtttcagaggtattaccagccccacacgctgtctccagaccaggaggactgc
atgtattggtacaacttcctagcctatcacatggctagtgccaatatgcacaaagaactt
tgtgctttaatgttttccctggactggattaaagcaaaaacagaacttgtcggccctgcc
catctgattcacgagttcgtggcatataggcatatattggatgaaaaggattgtgcagtc
tgtgagaattttcaagagtttttatctttaaatggacacctccttggacgacagccattt
cctaatattgtacagctgggcctctgtgaaccagaaacttccgaagtttatcgacaagca
aagctgcaggccaagcaggagggggatactgggcgcctttacctggaatggataaacaaa
aaaactatcaagaatctgtcccgcttagtcgtccgcccccacacagatgctgtttaccac
gcgtgtttttctcaggatggtcagagaatagcttcttgtggggctgataaaaccttacag
gtgttcaaagccgagacaggagagaaacttcttgacatcaaagctcacgaagatgaggtg
ctttgctgcgcgttctcctcagacgacagttacatagcgacctgctcagcggataagaag
gttaagatttgggattctgcgactgggaagcttgtgcacacctacgacgagcactcggag
caagtcaattgctgccatttcaccaacaagagtaaccaccttctcttggccactgggtca
aatgatttcttcctcaagctctgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcacacgaactcagtcaaccactgcaggttctcaccagacgatgagctcttggctagc
tgctcagctgacgggactttaaggctttgggatgtgagatcagcaaacgagaggaaaagc
attaatgtgaagcgcttcttcctgagttcagaagaccctccagaggatgtggaggtgatc
gtgaagtgttgttcctggtctgcagatggtgacaaaataatagtggcagcaaaaaacaaa
gtcctcctttttgatattcatactagtggcctattggcagagatccacacaggccatcac
agcaccatccagtactgtgacttctccccctatgaccatttggctgtgattgccctgtct
cagtactgtgtggagttgtggaacatagactcccgcctaaaggtggccgactgcagagga
catttgagttgggttcacggtgtgatgttttctcccgatggctcctcatttttgacagct
tctgatgaccaaacaataagggtctgggagacaaaaaaggtatgcaagaactctgccatc
gtgctaaagcaggaaatagacgtcgtgtttcaagagaacgaaacgatggtccttgcagtt
gacaacataagaggcctgcaactcattgctggaaaaacaggccagattgattacctgcct
gaagcccaagtgagttgctgctgcctcagtccacaccttgagtacgtggcattcggagat
gaagatggagccattaagattatagaacttccaaacaacagagtcttcagttctggggtt
gggcacaagaaagctgtgcggcacatccagttcacagctgatgggaagacactgatttca
agttctgaagattctgtgattcaggtatggaattggcagacaggggactatgtatttttg
caagcccaccaggaaacggtaaaggacttcaggctcctccaagattcaagattgctttct
tggtcatttgatggaacggtgaaggtgtggaatgtcattaccggaagaatagaaagagac
tttacttgtcatcagggcacagtgctttcctgtgctatctcttctgatgcgaccaagttt
tcatctacctctgctgataagactgccaagatctggagttttgacctcctttcccctctt
catgagctgaagggccataatggctgtgtccgctgctctgccttctcgctggatggcatc
ctgttggcaactggagatgacaatggagaaatccggatatggaatgtctcagatggccag
cttcttcattcgtgtgctccgatctcggtagaggaaggaactgctacccacggcggctgg
gtaactgatgtgtgcttctctcccgacagtaaaacgcttgtctctgctggaggatatctc
aagtggtggaatgttgccactggggactcctcacagaccttctacacaaatggaacaaac
ctcaagaaaatccacgtgtcccctgacttcagaacctatgtgactgtcgataatctcggt
attttatatattttacaggttttagagtga

DBGET integrated database retrieval system