KEGG   Mus musculus (mouse): 11796Help
Entry
11796             CDS       T01002                                 

Gene name
Birc3, AW107670, Api1, Api2, Birc2, C-IAP2, HIAP2, IAP1, IAP2, MIAP1, MIAP2, MIHB, MIHC, RNF49, cIAP-1, cIAP-2, cIAP1, cIAP2
Definition
(RefSeq) baculoviral IAP repeat-containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu05145  Toxoplasmosis
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11796 (Birc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11796 (Birc3)
   04668 TNF signaling pathway
    11796 (Birc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11796 (Birc3)
   04215 Apoptosis - multiple species
    11796 (Birc3)
   04217 Necroptosis
    11796 (Birc3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11796 (Birc3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11796 (Birc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11796 (Birc3)
   05202 Transcriptional misregulation in cancer
    11796 (Birc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    11796 (Birc3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    11796 (Birc3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11796 (Birc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11796 (Birc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    11796 (Birc3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11796 (Birc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 11796
NCBI-ProteinID: NP_031490
MGI: 1197007
Ensembl: ENSMUSG00000032000
Vega: OTTMUSG00000020585
UniProt: O08863 A2CGA5 Q3TSE5
LinkDB All DBs
Position
9; 9 A1
AA seq 602 aa AA seqDB search
MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGA
NDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMST
MPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWP
LSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQ
SASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLLRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENADAA
IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLL
DAEDEMREEQMEQAAEEEESDDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNA
VKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFVQQDIRSLPTDDIAAL
PMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttcaagacagcgcctttctagccaagctgatgaagagtgctgacaccttt
gagttgaagtatgacttttcctgtgagctgtaccgattgtccacgtattcagcttttccc
aggggagttcctgtgtcagaaaggagtctggctcgtgctggcttttactacactggtgcc
aatgacaaggtcaagtgcttctgctgtggcctgatgctagacaactggaaacaaggggac
agtcccatggagaagcacagaaagttgtaccccagctgcaactttgtacagactttgaat
ccagccaacagtctggaagctagtcctcggccttctcttccttccacggcgatgagcacc
atgcctttgagctttgcaagttctgagaatactggctatttcagtggctcttactcgagc
tttccctcagaccctgtgaacttccgagcaaatcaagattgtcctgctttgagcacaagt
ccctaccactttgcaatgaacacagagaaggccagattactcacctatgaaacatggcca
ttgtcttttctgtcaccagcaaagctggccaaagcaggcttctactacataggacctgga
gatagagtggcctgctttgcgtgcgatgggaaactgagcaactgggaacgtaaggatgat
gctatgtcagagcaccagaggcatttccccagctgtccgttcttaaaagacttgggtcag
tctgcttcgagatacactgtctctaacctgagcatgcagacacacgcagcccgtattaga
acattctctaactggccttctagtgcactagttcattcccaggaacttgcaagtgcgggc
ttttattatacaggacacagtgatgatgtcaagtgtttttgctgtgatggtgggctgagg
tgctgggaatctggagatgacccctgggtggaacatgccaagtggtttccaaggtgtgag
tacttgctcagaatcaaaggccaagaatttgtcagccaagttcaagctggctatcctcat
ctacttgagcagctattatctacgtcagactccccagaagatgagaatgcagacgcagca
atcgtgcattttggccctggagaaagttcggaagatgtcgtcatgatgagcacgcctgtg
gttaaagcagccttggaaatgggcttcagtaggagcctggtgagacagacggttcagtgg
cagatcctggccactggtgagaactacaggaccgtcagtgacctcgttataggcttactc
gatgcagaagacgagatgagagaggagcagatggagcaggcggccgaggaggaggagtca
gatgatctagcactaatccggaagaacaaaatggtgcttttccaacatttgacgtgtgtg
acaccaatgctgtattgcctcctaagtgcaagggccatcactgaacaggagtgcaatgct
gtgaaacagaaaccacacaccttacaagcaagcacactgattgatactgtgttagcaaaa
ggaaacactgcagcaacctcattcagaaactcccttcgggaaattgaccctgcgttatac
agagatatatttgtgcaacaggacattaggagtcttcccacagatgacattgcagctcta
ccaatggaagaacagttgcggaaactccaggaggaaagaatgtgtaaagtgtgtatggac
cgagaggtatccatcgtgttcattccctgtggccatctggtcgtgtgcaaagactgcgct
ccctctctgaggaagtgtcccatctgtagagggaccatcaagggcacagtgcgcacattt
ctctcctga

KEGG   Mus musculus (mouse): 11797Help
Entry
11797             CDS       T01002                                 

Gene name
Birc2, AW146227, Api1, Api2, Birc3, C-IAP1, C330006D17Rik, HIAP1, HIAP2, IAP1, IAP2, MIAP1, MIAP2, MIHB, MIHC, RNF48, cIAP1, cIAP2, mcIAP1
Definition
(RefSeq) baculoviral IAP repeat-containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu05145  Toxoplasmosis
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11797 (Birc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    11797 (Birc2)
   04064 NF-kappa B signaling pathway
    11797 (Birc2)
   04668 TNF signaling pathway
    11797 (Birc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11797 (Birc2)
   04215 Apoptosis - multiple species
    11797 (Birc2)
   04217 Necroptosis
    11797 (Birc2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11797 (Birc2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11797 (Birc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11797 (Birc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    11797 (Birc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    11797 (Birc2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11797 (Birc2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11797 (Birc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    11797 (Birc2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11797 (Birc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039
Motif
Other DBs
NCBI-GeneID: 11797
NCBI-ProteinID: NP_001278432
MGI: 1197009
Ensembl: ENSMUSG00000057367
Vega: OTTMUSG00000047468
UniProt: Q62210
LinkDB All DBs
Position
9; 9 A1
AA seq 612 aa AA seqDB search
MDKTVSQRLGQGTLHQKLKRIMEKSTILSNWTKESEEKMKFDFSCELYRMSTYSAFPRGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSAS
LQSPSKNMSPVKSRFAHSSPLERGGIHSNLCSSPLNSRAVEDFSSRMDPCSYAMSTEEAR
FLTYSMWPLSFLSPAELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHC
PFLENTSETQRFSISNLSMQTHSARLRTFLYWPPSVPVQPEQLASAGFYYVDRNDDVKCF
CCDGGLRCWEPGDDPWIEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPG
EENADPTETVVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRT
VNDIVSVLLNAEDERREEEKERQTEEMASGDLSLIRKNRMALFQQLTHVLPILDNLLEAS
VITKQEHDIIRQKTQIPLQARELIDTVLVKGNAAANIFKNSLKEIDSTLYENLFVEKNMK
YIPTEDVSGLSLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICR
GTIKGTVRTFLS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaactgtctcccagagactcggccaaggtaccttacaccaaaaacttaaacgt
ataatggagaagagcacaatcttgtcaaattggacaaaggagagcgaagaaaaaatgaag
tttgacttttcgtgtgaactctaccgaatgtctacatattcagcttttcccaggggagtt
cctgtctcagagaggagtctggctcgtgctggcttttattatacaggtgtgaatgacaaa
gtcaagtgcttctgctgtggcctgatgttggataactggaaacaaggggacagtcctgtt
gaaaagcacagacagttctatcccagctgcagctttgtacagactctgctttcagccagt
ctgcagtctccatctaagaatatgtctcctgtgaaaagtagatttgcacattcgtcacct
ctggaacgaggtggcattcactccaacctgtgctctagccctcttaattctagagcagtg
gaagacttctcatcaaggatggatccctgcagctatgccatgagtacagaagaggccaga
tttcttacttacagtatgtggcctttaagttttctgtcaccagcagagctggccagagct
ggcttctattacatagggcctggagacagggtggcctgttttgcctgtggtgggaaactg
agcaactgggaaccaaaggatgatgctatgtcagagcaccgcagacattttccccactgt
ccatttctggaaaatacttcagaaacacagaggtttagtatatcaaatctaagtatgcag
acacactctgctcgattgaggacatttctgtactggccacctagtgttcctgttcagccc
gagcagcttgcaagtgctggattctattacgtggatcgcaatgatgatgtcaagtgcttt
tgttgtgatggtggcttgagatgttgggaacctggagatgacccctggatagaacacgcc
aaatggtttccaaggtgtgagttcttgatacggatgaagggtcaggagtttgttgatgag
attcaagctagatatcctcatcttcttgagcagctgttgtccacttcagacaccccagga
gaagaaaatgctgaccctacagagacagtggtgcattttggccctggagaaagttcggaa
gatgtcgtcatgatgagcacgcctgtggttaaagcagccttggaaatgggcttcagtagg
agcctggtgagacagacggttcagcggcagatcctggccactggtgagaactacaggacc
gtcaatgatattgtctcagtacttttgaatgctgaagatgagagaagagaagaggagaag
gaaagacagactgaagagatggcatcaggtgacttatcactgattcggaagaatagaatg
gccctctttcaacagttgacacatgtccttcctatcctggataatcttcttgaggccagt
gtaattacaaaacaggaacatgatattattagacagaaaacacagatacccttacaagca
agagagcttattgacaccgttttagtcaagggaaatgctgcagccaacatcttcaaaaac
tctctgaaggaaattgactccacgttatatgaaaacttatttgtggaaaagaatatgaag
tatattccaacagaagacgtttcaggcttgtcattggaagagcagttgcggagattacaa
gaagaacgaacttgcaaagtgtgtatggacagagaggtttctattgtgttcattccgtgt
ggtcatctagtagtctgccaggaatgtgccccttctctaaggaagtgccccatctgcagg
gggacaatcaaggggactgtgcgcacatttctctcatga

KEGG   Mus musculus (mouse): 11798Help
Entry
11798             CDS       T01002                                 

Gene name
Xiap, 1110015C02Rik, Aipa, Api3, Birc4, IAP3, ILP-1, MIHA
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu05145  Toxoplasmosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11798 (Xiap)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11798 (Xiap)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11798 (Xiap)
   04215 Apoptosis - multiple species
    11798 (Xiap)
   04217 Necroptosis
    11798 (Xiap)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11798 (Xiap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11798 (Xiap)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11798 (Xiap)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    11798 (Xiap)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11798 (Xiap)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11798 (Xiap)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11798 (Xiap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    11798 (Xiap)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11798 (Xiap)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     11798 (Xiap)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11798 (Xiap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    11798 (Xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX DUF2039
Motif
Other DBs
NCBI-GeneID: 11798
NCBI-ProteinID: NP_001288568
MGI: 107572
Ensembl: ENSMUSG00000025860
Vega: OTTMUSG00000017444
UniProt: Q60989
LinkDB All DBs
Position
X; X A4
AA seq 496 aa AA seqDB search
MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENC
VGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPS
LTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDN
TEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCYTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggaactagaacttttgtacttgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagtagtagt
cctgtttcagcatcaacattggcgcgagctgggtttctttataccggtgaaggagacacc
gtgcaatgtttcagttgtcatgcggcaatagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaat
ggtgctgcacagtctacaaatcctggtatccaaaatggccagtacaaatctgaaaactgt
gtgggaaatagaaatccttttgcccctgacaggccacctgagactcatgctgattatctc
ttgagaactggacaggttgtagatatttcagacaccatatacccgaggaaccctgccatg
tgtagtgaagaagccagattgaagtcatttcagaactggccggactatgctcatttaacc
cccagagagttagctagtgctggcctctactacacaggggctgatgatcaagtgcaatgc
ttttgttgtgggggaaaactgaaaaattgggaaccctgtgatcgtgcctggtcagaacac
aggagacactttcccaattgcttttttgttttgggccggaacgttaatgttcgaagtgaa
tctggtgtgagttctgataggaatttcccaaattcaacaaactctccaagaaatccagcc
atggcagaatatgaagcacggatcgttacttttggaacatggacatcctcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggcgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgcg
aagtggtacccagggtgcaaatacctattggatgagaaggggcaagaatatataaataat
attcatttaacccattcacttgaggaatctttgggaagaactgctgaaaaaacaccatcg
ctaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggatttagcttcaaggacattaagaaaacaatggaagaaaaaatccaaacatccggg
agcagctatctatcacttgaggtcctgattgcagatcttgtgagtgctcagaaagataat
acggaggatgagtcaagtcaaacttcattgcagaaagacattagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcagaagcagttgacaaatgt
cccatgtgctacaccgtcattacgttcaagcaaaaaatttttatgtcttag

KEGG   Mus musculus (mouse): 329581Help
Entry
329581            CDS       T01002                                 

Gene name
Birc7, E130019N06, KIAP, Livin, ML-IAP
Definition
(RefSeq) baculoviral IAP repeat-containing 7 (livin)
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04215  Apoptosis - multiple species
mmu05145  Toxoplasmosis
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    329581 (Birc7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    329581 (Birc7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    329581 (Birc7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    329581 (Birc7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    329581 (Birc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    329581 (Birc7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    329581 (Birc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX zf-C3HC4 ArfGap
Motif
Other DBs
NCBI-GeneID: 329581
NCBI-ProteinID: NP_001156719
MGI: 2676458
Ensembl: ENSMUSG00000038840
Vega: OTTMUSG00000016404
UniProt: A2AWP0
LinkDB All DBs
Position
2; 2 H4
AA seq 285 aa AA seqDB search
MFSPADLFRAAVFSMGPESRARDSVRGPELSHREDGSGRTQEQDKPHCPCNHVLGQDCLD
GQILGQLRPLSEEEESSGAAFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFF
HTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQTYTPLLG
SWDQREEPEDAVSATPSAPAHGSPELLRSRRETQPEDVSEPGAKDVQEQLRQLQEERRCK
VCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFLS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttctcacctgcagacttattcagagctgctgtcttttccatggggcctgagagtagg
gccagggactcggtccgtggcccagaactaagccacagggaagatggcagtggccgcaca
caggaacaggataaaccccactgtccgtgtaaccatgtcctgggccaggactgcctagat
gggcagatcttaggccagcttcggcctctgtcagaagaggaagaatcctctggggctgcc
ttccttggggagcctgccttccctgagatggactcagaggatctccggctagcctccttc
tacgactggccatctactgcagggattcagcctgagccattggctgctgctgggttcttc
cacacaggccagcaggacaaggtgagatgtttcttctgctatgggggtctacagagctgg
gagcgtggggatgacccctggacagagcatgcccgatggtttcccaggtgtcagttcctg
ctacggtcaaaaggaagggactttgtggaaagaatccagacctacacccctttgctggga
tcctgggatcagcgagaagaaccagaagatgcagtctctgccactccctcagctcctgcc
catggaagccctgagttactcagatccagaagagagacccagcctgaagatgtcagtgag
ccaggagccaaggatgttcaggaacagctgcgacagctgcaggaagagaggagatgcaag
gtgtgcctggaccgagccgtctccatagtcttcgtgccctgtggccacttcgtctgcacc
gagtgtgctcccaacctgcagctgtgccctatctgcagggtgcctatctgtagctgtgta
cgcacattcctgtcctaa

DBGET integrated database retrieval system