KEGG   Mus musculus (mouse): 11798Help
Entry
11798             CDS       T01002                                 

Gene name
Xiap, 1110015C02Rik, Aipa, Api3, Birc4, IAP3, ILP-1, MIHA
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu05145  Toxoplasmosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11798 (Xiap)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11798 (Xiap)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11798 (Xiap)
   04215 Apoptosis - multiple species
    11798 (Xiap)
   04217 Necroptosis
    11798 (Xiap)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11798 (Xiap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11798 (Xiap)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11798 (Xiap)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    11798 (Xiap)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11798 (Xiap)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11798 (Xiap)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11798 (Xiap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    11798 (Xiap)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11798 (Xiap)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     11798 (Xiap)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11798 (Xiap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    11798 (Xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX DUF2039
Motif
Other DBs
NCBI-GeneID: 11798
NCBI-ProteinID: NP_001288568
MGI: 107572
Ensembl: ENSMUSG00000025860
Vega: OTTMUSG00000017444
UniProt: Q60989
LinkDB All DBs
Position
X; X A4
AA seq 496 aa AA seqDB search
MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENC
VGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPS
LTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDN
TEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCYTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggaactagaacttttgtacttgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagtagtagt
cctgtttcagcatcaacattggcgcgagctgggtttctttataccggtgaaggagacacc
gtgcaatgtttcagttgtcatgcggcaatagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaat
ggtgctgcacagtctacaaatcctggtatccaaaatggccagtacaaatctgaaaactgt
gtgggaaatagaaatccttttgcccctgacaggccacctgagactcatgctgattatctc
ttgagaactggacaggttgtagatatttcagacaccatatacccgaggaaccctgccatg
tgtagtgaagaagccagattgaagtcatttcagaactggccggactatgctcatttaacc
cccagagagttagctagtgctggcctctactacacaggggctgatgatcaagtgcaatgc
ttttgttgtgggggaaaactgaaaaattgggaaccctgtgatcgtgcctggtcagaacac
aggagacactttcccaattgcttttttgttttgggccggaacgttaatgttcgaagtgaa
tctggtgtgagttctgataggaatttcccaaattcaacaaactctccaagaaatccagcc
atggcagaatatgaagcacggatcgttacttttggaacatggacatcctcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggcgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgcg
aagtggtacccagggtgcaaatacctattggatgagaaggggcaagaatatataaataat
attcatttaacccattcacttgaggaatctttgggaagaactgctgaaaaaacaccatcg
ctaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggatttagcttcaaggacattaagaaaacaatggaagaaaaaatccaaacatccggg
agcagctatctatcacttgaggtcctgattgcagatcttgtgagtgctcagaaagataat
acggaggatgagtcaagtcaaacttcattgcagaaagacattagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcagaagcagttgacaaatgt
cccatgtgctacaccgtcattacgttcaagcaaaaaatttttatgtcttag

DBGET integrated database retrieval system