KEGG   Mus musculus (mouse): 11839
Entry
11839             CDS       T01002                                 

Gene name
Areg, AR, Mcub, Sdg, Sdgf
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11839 (Areg)
   04012 ErbB signaling pathway
    11839 (Areg)
   04390 Hippo signaling pathway
    11839 (Areg)
   04151 PI3K-Akt signaling pathway
    11839 (Areg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    11839 (Areg)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   11839 (Areg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   11839 (Areg)
SSDB
Motif
Pfam: Rieske FtsL Pestivirus_E2 DUF2207 EGF
Other DBs
NCBI-GeneID: 11839
NCBI-ProteinID: NP_033834
MGI: 88068
Ensembl: ENSMUSG00000029378
Vega: OTTMUSG00000055520
UniProt: P31955 Q4FJT2
LinkDB
Position
5 E2; 5 44.78 cM
AA seq 248 aa
MRTPLLPLARSVLLLLVLGSGHYAAALELNDPSSGKGESLSGDHSAGGLELSVGREVSTI
SEMPSGSELSTGDYDYSEEYDNEPQISGYIIDDSVRVEQVIKPKKNKTEGEKSTEKPKRK
KKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMK
THSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQE
NGTVHAIA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagaactccgctgctaccgctggcgcgctcagtgctgttgctgctggtcttaggctca
ggccattatgcagctgctttggagctcaatgaccccagctcagggaaaggcgaatcgctt
tctggggaccacagtgccggtggacttgagctttctgtgggaagagaggtttccaccata
agcgaaatgccttctggcagtgaactctccacaggggactacgactactcagaggagtat
gataatgaaccacaaatatccggctatattatagatgattcagtcagagttgaacaggtg
attaagcccaagaaaaacaagacagaaggagaaaagtctacagaaaaacccaaaaggaag
aaaaagggaggcaaaaatggaaaaggcagaaggaataagaagaaaaagaatccatgcact
gccaagtttcagaacttttgcattcatggcgaatgcagatacatcgagaacctggaggtg
gtgacatgcaattgtcatcaagattactttggtgaacggtgtggagaaaaatccatgaag
actcacagcgaggatgacaaggacctatccaagattgcagtagtagctgtcactatcttt
gtctctgccatcatcctcgcagctattggcatcggcatcgttatcacagtgcacctttgg
aaacgatacttcagggaatatgaaggagaaacagaagaaagaaggaggcttcgacaagaa
aacgggactgtgcatgccattgcctag

DBGET integrated database retrieval system