KEGG   Mus musculus (mouse): 11848Help
Entry
11848             CDS       T01002                                 

Gene name
Rhoa, Arha, Arha1, Arha2
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04972  Pancreatic secretion
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11848 (Rhoa)
   04015 Rap1 signaling pathway
    11848 (Rhoa)
   04310 Wnt signaling pathway
    11848 (Rhoa)
   04350 TGF-beta signaling pathway
    11848 (Rhoa)
   04072 Phospholipase D signaling pathway
    11848 (Rhoa)
   04071 Sphingolipid signaling pathway
    11848 (Rhoa)
   04024 cAMP signaling pathway
    11848 (Rhoa)
   04022 cGMP-PKG signaling pathway
    11848 (Rhoa)
   04150 mTOR signaling pathway
    11848 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11848 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11848 (Rhoa)
   04520 Adherens junction
    11848 (Rhoa)
   04530 Tight junction
    11848 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    11848 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11848 (Rhoa)
   04621 NOD-like receptor signaling pathway
    11848 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    11848 (Rhoa)
   04660 T cell receptor signaling pathway
    11848 (Rhoa)
   04670 Leukocyte transendothelial migration
    11848 (Rhoa)
   04062 Chemokine signaling pathway
    11848 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    11848 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    11848 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    11848 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    11848 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11848 (Rhoa)
  09158 Development
   04360 Axon guidance
    11848 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11848 (Rhoa)
   05206 MicroRNAs in cancer
    11848 (Rhoa)
   05205 Proteoglycans in cancer
    11848 (Rhoa)
   05203 Viral carcinogenesis
    11848 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11848 (Rhoa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11848 (Rhoa)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    11848 (Rhoa)
   05133 Pertussis
    11848 (Rhoa)
   05152 Tuberculosis
    11848 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    11848 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    11848 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11848 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11848 (Rhoa)
   04031 GTP-binding proteins [BR:mmu04031]
    11848 (Rhoa)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    11848 (Rhoa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11848 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   11848 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   11848 (Rhoa)
  Exosomal proteins of bladder cancer cells
   11848 (Rhoa)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    11848 (Rhoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 11848
NCBI-ProteinID: NP_001300890
MGI: 1096342
Ensembl: ENSMUSG00000007815
Vega: OTTMUSG00000050752
UniProt: Q9QUI0 Q4VAE6
LinkDB All DBs
Structure
PDB: 

Position
9; 9 F1-F2
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa
aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgcggcctctctcttatccagacaccgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgacgagcacacgagacgggagttggccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgtgggaagaaaaagtctgggtgcctcatcttgtga

KEGG   Mus musculus (mouse): 170758Help
Entry
170758            CDS       T01002                                 

Gene name
Rac3, Rac1B
Definition
(RefSeq) Rac family small GTPase 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    170758 (Rac3)
   04015 Rap1 signaling pathway
    170758 (Rac3)
   04010 MAPK signaling pathway
    170758 (Rac3)
   04310 Wnt signaling pathway
    170758 (Rac3)
   04370 VEGF signaling pathway
    170758 (Rac3)
   04071 Sphingolipid signaling pathway
    170758 (Rac3)
   04024 cAMP signaling pathway
    170758 (Rac3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170758 (Rac3)
   04520 Adherens junction
    170758 (Rac3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170758 (Rac3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    170758 (Rac3)
   04662 B cell receptor signaling pathway
    170758 (Rac3)
   04664 Fc epsilon RI signaling pathway
    170758 (Rac3)
   04062 Chemokine signaling pathway
    170758 (Rac3)
  09158 Development
   04360 Axon guidance
    170758 (Rac3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170758 (Rac3)
   05231 Choline metabolism in cancer
    170758 (Rac3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    170758 (Rac3)
   05212 Pancreatic cancer
    170758 (Rac3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    170758 (Rac3)
   05416 Viral myocarditis
    170758 (Rac3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    170758 (Rac3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    170758 (Rac3)
   05163 Human cytomegalovirus infection
    170758 (Rac3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    170758 (Rac3)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    170758 (Rac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 170758
NCBI-ProteinID: NP_573486
MGI: 2180784
Ensembl: ENSMUSG00000018012
Vega: OTTMUSG00000004093
UniProt: P60764 Q14A12
LinkDB All DBs
Position
11; 11 E2
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggttggcgatggtgccgtggggaagacgtgcctgctg
atcagctacacgaccaacgccttcccaggagaatatatccccacagttttcgacaactac
tcagccaacgtgatggtggatgggaagccagttaacctggggctgtgggacactgctggc
caggaagactacgataggcttcggccactctcctatcctcaaacagatgtctttctgatc
tgcttctccctggtgagcccagcctcctttgagaatgtccgtgccaagtggtacccagag
gtgcggcaccactgcccacacacacccatccttctggtgggcaccaagctggacctccgt
gatgacaaggatacgattgaacggctgcgggacaagaagctggcacccataacctacccc
caaggcctggccatggcccgagagattggttccgtcaagtacctggagtgctcagctctg
acccagagaggtctgaagacagtgttcgacgaggccatccgggctgtgctctgcccacct
ccagtgaaaaagccaggcaagaagtgcactgtattctag

KEGG   Mus musculus (mouse): 19353Help
Entry
19353             CDS       T01002                                 

Gene name
Rac1, AL023026, D5Ertd559e
Definition
(RefSeq) Rac family small GTPase 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04972  Pancreatic secretion
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19353 (Rac1)
   04015 Rap1 signaling pathway
    19353 (Rac1)
   04010 MAPK signaling pathway
    19353 (Rac1)
   04310 Wnt signaling pathway
    19353 (Rac1)
   04370 VEGF signaling pathway
    19353 (Rac1)
   04071 Sphingolipid signaling pathway
    19353 (Rac1)
   04024 cAMP signaling pathway
    19353 (Rac1)
   04151 PI3K-Akt signaling pathway
    19353 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    19353 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19353 (Rac1)
   04520 Adherens junction
    19353 (Rac1)
   04530 Tight junction
    19353 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19353 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    19353 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    19353 (Rac1)
   04662 B cell receptor signaling pathway
    19353 (Rac1)
   04664 Fc epsilon RI signaling pathway
    19353 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    19353 (Rac1)
   04670 Leukocyte transendothelial migration
    19353 (Rac1)
   04062 Chemokine signaling pathway
    19353 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    19353 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19353 (Rac1)
  09158 Development
   04360 Axon guidance
    19353 (Rac1)
   04380 Osteoclast differentiation
    19353 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19353 (Rac1)
   05205 Proteoglycans in cancer
    19353 (Rac1)
   05203 Viral carcinogenesis
    19353 (Rac1)
   05231 Choline metabolism in cancer
    19353 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    19353 (Rac1)
   05212 Pancreatic cancer
    19353 (Rac1)
   05211 Renal cell carcinoma
    19353 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    19353 (Rac1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19353 (Rac1)
   05416 Viral myocarditis
    19353 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19353 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    19353 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19353 (Rac1)
   05135 Yersinia infection
    19353 (Rac1)
   05100 Bacterial invasion of epithelial cells
    19353 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19353 (Rac1)
   05163 Human cytomegalovirus infection
    19353 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19353 (Rac1)
   05169 Epstein-Barr virus infection
    19353 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19353 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19353 (Rac1)
   04031 GTP-binding proteins [BR:mmu04031]
    19353 (Rac1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    19353 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    19353 (Rac1)
  Phagocytosis
   NADPH oxidase complex
    19353 (Rac1)
  Macropinocytosis
   Ras GTPases
    19353 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    19353 (Rac1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19353 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   19353 (Rac1)
  Exosomal proteins of colorectal cancer cells
   19353 (Rac1)
  Exosomal proteins of bladder cancer cells
   19353 (Rac1)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19353 (Rac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Motif
Other DBs
NCBI-GeneID: 19353
NCBI-ProteinID: NP_033033
MGI: 97845
Ensembl: ENSMUSG00000001847
Vega: OTTMUSG00000020705
UniProt: P63001 K7Q7T7
LinkDB All DBs
Position
5 G2; 5 82.22 cM
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc
atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcctatgggacacagctgga
caagaagattatgacagattgcgtcccctctcctacccgcagacagacgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtgcgacaccactgtcccaatactcctatcatcctcgtggggacgaagcttgatcttagg
gatgataaggacaccattgagaagctgaaggagaagaagctgactcccatcacctacccg
caggggctggccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctc
acacagcgaggactcaagacagtgtttgacgaagctatccgagcggttctctgtccccct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Mus musculus (mouse): 19354Help
Entry
19354             CDS       T01002                                 

Gene name
Rac2, AI323801, AI452260
Definition
(RefSeq) Rac family small GTPase 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19354 (Rac2)
   04015 Rap1 signaling pathway
    19354 (Rac2)
   04010 MAPK signaling pathway
    19354 (Rac2)
   04310 Wnt signaling pathway
    19354 (Rac2)
   04370 VEGF signaling pathway
    19354 (Rac2)
   04071 Sphingolipid signaling pathway
    19354 (Rac2)
   04024 cAMP signaling pathway
    19354 (Rac2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19354 (Rac2)
   04520 Adherens junction
    19354 (Rac2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19354 (Rac2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    19354 (Rac2)
   04662 B cell receptor signaling pathway
    19354 (Rac2)
   04664 Fc epsilon RI signaling pathway
    19354 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    19354 (Rac2)
   04670 Leukocyte transendothelial migration
    19354 (Rac2)
   04062 Chemokine signaling pathway
    19354 (Rac2)
  09158 Development
   04360 Axon guidance
    19354 (Rac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19354 (Rac2)
   05231 Choline metabolism in cancer
    19354 (Rac2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    19354 (Rac2)
   05212 Pancreatic cancer
    19354 (Rac2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19354 (Rac2)
   05416 Viral myocarditis
    19354 (Rac2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    19354 (Rac2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19354 (Rac2)
   05163 Human cytomegalovirus infection
    19354 (Rac2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19354 (Rac2)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19354 (Rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 19354
NCBI-ProteinID: NP_033034
MGI: 97846
Ensembl: ENSMUSG00000033220
UniProt: Q05144
LinkDB All DBs
Position
15; 15 E1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRPCSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacgtgtcttctc
atcagctacaccaccaacgccttccctggagaatacatccccactgtatttgacaactac
tcagccaatgtgatggtggacagtaagccggtgaacctggggctgtgggataccgcaggt
caggaggactatgaccgcctccggccactctcctacccacagacagatgtatttctcatc
tgcttctcgctagtcagcccagcctcctatgagaatgtccgtgccaagtggttccctgag
gtacggcaccactgccccagcacccccatcatcctggtgggtaccaagctggaccttcgc
gatgacaaggacaccatcgagaagctgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggatattgattcagtcaagtacttggaatgttctgcactc
acccagcgaggcctgaagaccgtcttcgatgaggcaatccgcgcagtcctctgcccacag
cccacacgacagcagaagcgcccctgcagcctgctctag

KEGG   Mus musculus (mouse): 67653Help
Entry
67653             CDS       T01002                                 

Gene name
4930544G11Rik
Definition
(RefSeq) RIKEN cDNA 4930544G11 gene
  KO
K04513  Ras homolog gene family, member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04972  Pancreatic secretion
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    67653 (4930544G11Rik)
   04015 Rap1 signaling pathway
    67653 (4930544G11Rik)
   04310 Wnt signaling pathway
    67653 (4930544G11Rik)
   04350 TGF-beta signaling pathway
    67653 (4930544G11Rik)
   04072 Phospholipase D signaling pathway
    67653 (4930544G11Rik)
   04071 Sphingolipid signaling pathway
    67653 (4930544G11Rik)
   04024 cAMP signaling pathway
    67653 (4930544G11Rik)
   04022 cGMP-PKG signaling pathway
    67653 (4930544G11Rik)
   04150 mTOR signaling pathway
    67653 (4930544G11Rik)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    67653 (4930544G11Rik)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    67653 (4930544G11Rik)
   04520 Adherens junction
    67653 (4930544G11Rik)
   04530 Tight junction
    67653 (4930544G11Rik)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67653 (4930544G11Rik)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    67653 (4930544G11Rik)
   04621 NOD-like receptor signaling pathway
    67653 (4930544G11Rik)
   04625 C-type lectin receptor signaling pathway
    67653 (4930544G11Rik)
   04660 T cell receptor signaling pathway
    67653 (4930544G11Rik)
   04670 Leukocyte transendothelial migration
    67653 (4930544G11Rik)
   04062 Chemokine signaling pathway
    67653 (4930544G11Rik)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    67653 (4930544G11Rik)
   04928 Parathyroid hormone synthesis, secretion and action
    67653 (4930544G11Rik)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    67653 (4930544G11Rik)
  09154 Digestive system
   04972 Pancreatic secretion
    67653 (4930544G11Rik)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    67653 (4930544G11Rik)
  09158 Development
   04360 Axon guidance
    67653 (4930544G11Rik)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67653 (4930544G11Rik)
   05206 MicroRNAs in cancer
    67653 (4930544G11Rik)
   05205 Proteoglycans in cancer
    67653 (4930544G11Rik)
   05203 Viral carcinogenesis
    67653 (4930544G11Rik)
  09162 Cancer: specific types
   05210 Colorectal cancer
    67653 (4930544G11Rik)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    67653 (4930544G11Rik)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    67653 (4930544G11Rik)
   05133 Pertussis
    67653 (4930544G11Rik)
   05152 Tuberculosis
    67653 (4930544G11Rik)
   05100 Bacterial invasion of epithelial cells
    67653 (4930544G11Rik)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    67653 (4930544G11Rik)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67653 (4930544G11Rik)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    67653 (4930544G11Rik)
   04031 GTP-binding proteins [BR:mmu04031]
    67653 (4930544G11Rik)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    67653 (4930544G11Rik)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   67653 (4930544G11Rik)
  Exosomal proteins of other body fluids (saliva and urine)
   67653 (4930544G11Rik)
  Exosomal proteins of colorectal cancer cells
   67653 (4930544G11Rik)
  Exosomal proteins of bladder cancer cells
   67653 (4930544G11Rik)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    67653 (4930544G11Rik)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB
Motif
Other DBs
NCBI-GeneID: 67653
NCBI-ProteinID: NP_001155245
MGI: 1914903
Ensembl: ENSMUSG00000036463
Vega: OTTMUSG00000057253
UniProt: Q9CR99
LinkDB All DBs
Position
6; 6 C1
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVLLLCFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKD
LRNDFYTIQELAKRKQAPVRPEQGQGLANSIGAFEYVECSAKTKDGVRRVFEKATRAALQ
TNRVKKKTGCFVF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgatcgtgggagatggagcttgtggaaaaacatgt
ttgctcatcgtcttcagcaaggaccagtttcctgaggtttacgtgcccacagtatttgag
aactatgtggctgatatcgaagtggatggaaaacaggtggagttggccctgtgggataca
gctggacaagaagattatgatcgcctgaggccactctcctatcccgacactgatgttctc
ttgttatgtttctccattggcaaccctgatagctttgggaacatcccacataaatggatt
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggagtaagaaggat
cttcggaatgacttctacacgatacaagagttagccaagaggaagcaagcgcctgtgaga
cctgaacaaggccaagggttggcgaacagcattggcgctttcgagtatgtggagtgttca
gcgaagaccaaagatggagtgaggagggtctttgaaaaggccacaagggctgctctgcaa
acgaatcgagtgaagaaaaagactggttgctttgtcttttga

DBGET integrated database retrieval system