KEGG   Mus musculus (mouse): 11848Help
Entry
11848             CDS       T01002                                 

Gene name
Rhoa, Arha, Arha1, Arha2
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04972  Pancreatic secretion
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11848 (Rhoa)
   04015 Rap1 signaling pathway
    11848 (Rhoa)
   04310 Wnt signaling pathway
    11848 (Rhoa)
   04350 TGF-beta signaling pathway
    11848 (Rhoa)
   04072 Phospholipase D signaling pathway
    11848 (Rhoa)
   04071 Sphingolipid signaling pathway
    11848 (Rhoa)
   04024 cAMP signaling pathway
    11848 (Rhoa)
   04022 cGMP-PKG signaling pathway
    11848 (Rhoa)
   04150 mTOR signaling pathway
    11848 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11848 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11848 (Rhoa)
   04520 Adherens junction
    11848 (Rhoa)
   04530 Tight junction
    11848 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    11848 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    11848 (Rhoa)
   04621 NOD-like receptor signaling pathway
    11848 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    11848 (Rhoa)
   04660 T cell receptor signaling pathway
    11848 (Rhoa)
   04670 Leukocyte transendothelial migration
    11848 (Rhoa)
   04062 Chemokine signaling pathway
    11848 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    11848 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    11848 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    11848 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    11848 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11848 (Rhoa)
  09158 Development and regeneration
   04360 Axon guidance
    11848 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11848 (Rhoa)
   05206 MicroRNAs in cancer
    11848 (Rhoa)
   05205 Proteoglycans in cancer
    11848 (Rhoa)
   05203 Viral carcinogenesis
    11848 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11848 (Rhoa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11848 (Rhoa)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    11848 (Rhoa)
   05133 Pertussis
    11848 (Rhoa)
   05152 Tuberculosis
    11848 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    11848 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    11848 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11848 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11848 (Rhoa)
   04031 GTP-binding proteins [BR:mmu04031]
    11848 (Rhoa)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    11848 (Rhoa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11848 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   11848 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   11848 (Rhoa)
  Exosomal proteins of bladder cancer cells
   11848 (Rhoa)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    11848 (Rhoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 11848
NCBI-ProteinID: NP_001300890
MGI: 1096342
Ensembl: ENSMUSG00000007815
Vega: OTTMUSG00000050752
UniProt: Q9QUI0 Q4VAE6
LinkDB All DBs
Structure
PDB: 

Position
9; 9 F1-F2
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa
aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgcggcctctctcttatccagacaccgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgacgagcacacgagacgggagttggccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgtgggaagaaaaagtctgggtgcctcatcttgtga

KEGG   Mus musculus (mouse): 67653Help
Entry
67653             CDS       T01002                                 

Gene name
4930544G11Rik
Definition
(RefSeq) RIKEN cDNA 4930544G11 gene
  KO
K04513  Ras homolog gene family, member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04972  Pancreatic secretion
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    67653 (4930544G11Rik)
   04015 Rap1 signaling pathway
    67653 (4930544G11Rik)
   04310 Wnt signaling pathway
    67653 (4930544G11Rik)
   04350 TGF-beta signaling pathway
    67653 (4930544G11Rik)
   04072 Phospholipase D signaling pathway
    67653 (4930544G11Rik)
   04071 Sphingolipid signaling pathway
    67653 (4930544G11Rik)
   04024 cAMP signaling pathway
    67653 (4930544G11Rik)
   04022 cGMP-PKG signaling pathway
    67653 (4930544G11Rik)
   04150 mTOR signaling pathway
    67653 (4930544G11Rik)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    67653 (4930544G11Rik)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    67653 (4930544G11Rik)
   04520 Adherens junction
    67653 (4930544G11Rik)
   04530 Tight junction
    67653 (4930544G11Rik)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67653 (4930544G11Rik)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    67653 (4930544G11Rik)
   04621 NOD-like receptor signaling pathway
    67653 (4930544G11Rik)
   04625 C-type lectin receptor signaling pathway
    67653 (4930544G11Rik)
   04660 T cell receptor signaling pathway
    67653 (4930544G11Rik)
   04670 Leukocyte transendothelial migration
    67653 (4930544G11Rik)
   04062 Chemokine signaling pathway
    67653 (4930544G11Rik)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    67653 (4930544G11Rik)
   04928 Parathyroid hormone synthesis, secretion and action
    67653 (4930544G11Rik)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    67653 (4930544G11Rik)
  09154 Digestive system
   04972 Pancreatic secretion
    67653 (4930544G11Rik)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    67653 (4930544G11Rik)
  09158 Development and regeneration
   04360 Axon guidance
    67653 (4930544G11Rik)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67653 (4930544G11Rik)
   05206 MicroRNAs in cancer
    67653 (4930544G11Rik)
   05205 Proteoglycans in cancer
    67653 (4930544G11Rik)
   05203 Viral carcinogenesis
    67653 (4930544G11Rik)
  09162 Cancer: specific types
   05210 Colorectal cancer
    67653 (4930544G11Rik)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    67653 (4930544G11Rik)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    67653 (4930544G11Rik)
   05133 Pertussis
    67653 (4930544G11Rik)
   05152 Tuberculosis
    67653 (4930544G11Rik)
   05100 Bacterial invasion of epithelial cells
    67653 (4930544G11Rik)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    67653 (4930544G11Rik)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67653 (4930544G11Rik)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    67653 (4930544G11Rik)
   04031 GTP-binding proteins [BR:mmu04031]
    67653 (4930544G11Rik)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    67653 (4930544G11Rik)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   67653 (4930544G11Rik)
  Exosomal proteins of other body fluids (saliva and urine)
   67653 (4930544G11Rik)
  Exosomal proteins of colorectal cancer cells
   67653 (4930544G11Rik)
  Exosomal proteins of bladder cancer cells
   67653 (4930544G11Rik)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    67653 (4930544G11Rik)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB
Motif
Other DBs
NCBI-GeneID: 67653
NCBI-ProteinID: NP_001155245
MGI: 1914903
Ensembl: ENSMUSG00000036463
Vega: OTTMUSG00000057253
UniProt: Q9CR99
LinkDB All DBs
Position
6; 6 C1
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVLLLCFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKD
LRNDFYTIQELAKRKQAPVRPEQGQGLANSIGAFEYVECSAKTKDGVRRVFEKATRAALQ
TNRVKKKTGCFVF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgatcgtgggagatggagcttgtggaaaaacatgt
ttgctcatcgtcttcagcaaggaccagtttcctgaggtttacgtgcccacagtatttgag
aactatgtggctgatatcgaagtggatggaaaacaggtggagttggccctgtgggataca
gctggacaagaagattatgatcgcctgaggccactctcctatcccgacactgatgttctc
ttgttatgtttctccattggcaaccctgatagctttgggaacatcccacataaatggatt
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggagtaagaaggat
cttcggaatgacttctacacgatacaagagttagccaagaggaagcaagcgcctgtgaga
cctgaacaaggccaagggttggcgaacagcattggcgctttcgagtatgtggagtgttca
gcgaagaccaaagatggagtgaggagggtctttgaaaaggccacaagggctgctctgcaa
acgaatcgagtgaagaaaaagactggttgctttgtcttttga

DBGET integrated database retrieval system