KEGG   Mus musculus (mouse): 11906Help
Entry
11906             CDS       T01002                                 

Gene name
Zfhx3, A230102L03Rik, Atbf1, Sci, WBP9, mKIAA4228
Definition
(RefSeq) zinc finger homeobox 3
  KO
K09378  AT-binding transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11906 (Zfhx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11906 (Zfhx3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain plus zinc finger motifs
    11906 (Zfhx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain zf-C2H2_4 zf-C2H2 Homeobox_KN zf-met zf-Di19 zf-H2C2_5 MerR_1 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 11906
NCBI-ProteinID: NP_031522
MGI: 99948
Ensembl: ENSMUSG00000038872
Vega: OTTMUSG00000041077
UniProt: E9QMD3
LinkDB All DBs
Position
8; 8 D3
AA seq 3723 aa AA seqDB search
MEGCDSPVVSGKDNGCGIPQHRQWTELNSAHLPDKPSSMEQPTGESHGPLDSLRAPFNER
LADSSTSAGPPAEPASKEVSCNECSASFSSLQTYMEHHCPGTHPPPALREESASDTSEEG
EEESDVENLAGEIVYQPDGSAYIVESLSQLAQSGAACGSSSGSGAVPSLFLNSLPGVGGK
QGDPSCAAPVYPQIINTFHIASSFGKWFEGSDPAFPNTSALAGLSPVLHSFRVFDVRHKS
NKDYLNSDGSAKSSCVSKDVPNNVDLSKFDGFVLYGKRKPILMCFLCKLSFGYVRSFVTH
AVHDHRMTLSEEERKLLSNKNISAIIQGIGKDKEPLVSFLEPKNKNFQHPLVSTANLIGP
GHSFYGKFSGIRMEGEEALPAVAAAGPEQPQAGLLTPSTLLNLGGLTSSVLKTPITSVPL
GPLASSPTKSSEGKDSGAAEGDKQESGGHQDCFSEKVEPAEEEEAEEEEEEEEEAEEEEE
EEEEEEEEEEEGCKGLFPNDLEEELEDRPSEESGAPAGGSSKKDLALSNQSISNSPLMPN
VLQTLSRGPASTTSNSASNFVVFDGANRRSRLSFNSEGVRANVAEGRRLDFADESANKDS
ATAPEPNESTEGDDGGFVPHHQHAGSLCELGVGECPSGSGVECPKCDTVLGSSRSLGGHM
TMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGGSCVYCKSGQPHPRLARGESY
TCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQNLQNGGGEQVFSHSAGAAAAAAAA
AAAAANIGSSCGAPSPTKPKTKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNM
TQIQHNRHLGLGSLPSPAEAELYQYYLAQNMNLPNLKMDSTASDAQFMMSGFQLDPTGPM
AAMTPALVGGEIPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLD
MLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIK
EGGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHES
GVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIF
TIRRCPSTDPEEAVEDAEGPSEASADPEELAKDQGSGSEEGQSKRAASSSQAEKELTDSP
ATTKRTSFPGSSETPLSSKRPKASEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQP
LLRCPLCQDMLNNKIHLQLHLTHLHSVAPDCVEKLIMTVTAPEMVMPSSMFLPAAAADRD
GNSTLEEAGKQPEASEDPGKNILPPASMEHGGDLKPTSADPSCGREDSGFLCWKKGCNQV
FKTSATLQTHFNEVHAKRPQLPVSDRHVYKYRCNQCSLAFKTIEKLQLHSQYHVIRAATM
CCLCQRSFRTFQALKKHLETSHLELSEADIQQLYGGLLANGDLLAMGDPTLAEDHTIIVE
EDKEEESDLEDKQSPTGSDSGSVQEDSGSEPKRALPFRKGPNFTMEKFLDPSRPYKCTVC
KESFTQKNILLVHYNSVSHLHKLKRALQESATGQPEPTSSPDNKPFKCNTCNVAYSQSST
LEIHMRSVLHQTKARAAKLEAASGNSNGTGNSGGVSLSSSTPSPVGSSGANNTFTATNPS
SAAMAPSVNALSQVPPESVVMPPLGNPISANIASPSEPKEANRKKLADMIASRQQQQQQQ
QQQQQQAQTLAQAQAQVQAHLQQELQQQAALIQSQLFNPTLLPHFPMTTETLLQLQQQQH
LLFPFYIPSAEFQLNPEVSLPVTSGALTLTGSGPGLLEDLKAQVQIPQQSHQQILQQQQQ
QSQLSLSQSHSALLQPSQHPEKKNKVVIKEKDKESQREREGPEGAEGNTGPKESLPDASK
AKEKKDLAPGGGSEGTMLPPRIASDARGNATKALLENFGFELVIQYNENKQKAQKKNGKA
EQGGESLEKLECDSCGKLFSNILILKSHQEHVHQNYFPFKQLERFAKQYREHYDKLYPLR
PQTPEPPPPPPPPPPPPLPTAPPQPASAPAIPASAPPITSPTIAPAQPSVPLTQLSMPME
LPIFSPLMMQTMPLQTLPAQLPPQLGPVEPLPADLAQLYQHQLNPTLLQQQNKRPRTRIT
DDQLRVLRQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQRNKDSPYNFSN
PPITSLEELKIDSRPPSPEPQKQEYWGSKRSSRTRFTDYQLRVLQDFFDANAYPKDDEFE
QLSNLLNLPTRVIVVWFQNARQKARKNYENQGEGKDGERRELTNDRYIRTSNLNYQCKKC
SLVFQRIFDLIKHQKKLCYKDEDEEGQDDSQNEDSMDAMEILTPTSSSCSTPMPSQAYST
PAPSAAAANTAPSAFLQLTAETDELATFNSKAEASDEKPKQADPPSAQPNQTQEKQGQPK
PEMQQQLEQLEQKTNAPQPKLPQPAAPSLPQPPPQAPPPQCPLPQSSPSPSQLSHLPLKP
LHTSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQEHQQLHFLSAQNQFIHPQFLDRSLD
MPFMLFDPSNPLLASQLLSGAIPQIPASSATSPSTPTSTMNTLKRKLEEKASASPGENDS
GTGGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQN
TRARERKGQFRAVGPAQAHRRCPFCRALFKAKTALEAHIRSRHWHEAKRAGYNLTLSAML
LDCDGGLQMKGDIFDGTSFSHLPPSSSDGQGVPLSPVSKTMELSPRTLLSPSSIKVEGIE
DFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSAPN
EGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEGTVDYSETSSLADPCSPSPGASG
SAGKSGDGGDRPGQKRFRTQMTNLQLKVLKSCFNDYRTPTMLECEVLGNDIGLPKRVVQV
WFQNARAKEKKSKLSMAKHFGINQTSYEGPKTECTLCGIKYSARLSVRDHIFSQQHISKV
KDTIGSQLDKEKEYFDPATVRQLMAQQELDRIKKANEVLGLAAQQQGMFDNAPLQALNLP
TTYPALQGIPPVLLPGLNSPSLPGFTPANTALTSPKPNLMGLPSTTVPSPGLPTSGLPNK
PSSASLSSPTPAQATMAMAPQPPPQPQQPQPPVQQPPPPPAAQQIPAPQLTPQQQRKDKD
GEKGKEKEKAHKGKGEPLPVPKKEKGEAPPAATATISAPLPAMEYAVDPAQLQALQAALT
SDPTALLTSQFLPYFVPGFSPYYAPQIPGALQSGYLQPMYGMEGLFPYSPALSQALMGLS
PGSLLQQYQQYQQSLQEAIQQQQQQQQQQQQQQQRQLQQQQQQQQQKVQQQQQQQQQPKA
SQTPVPQGPASPDKDPAKESPKPEEQKNVPREVSPLLPKPPEEPEAESKSASADSLCDPF
IVPKVQYKLVCRKCQAGFGDEEAARSHLKSLCCFGQSVVNLQEMVLHVPTGSGGSGGGGG
GSGGGGGSYHCLACESALCGEEALSQHLESALHKHRTITRAARNAKEHPSLLPHSACFPD
PSTASTSQSAAHSNDSPPPPSAAPSSSASPHASRKSWPPVGSRASAAKPPSFPPLSSSST
VTSSSCSTSGVQPSMPTDDYSEESDTDLSQKSDGPASPVEGPKDPSCPKDSGLTSVGTDT
FRL
NT seq 11172 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctgtgactcgcccgtcgtctcggggaaggacaatgggtgcgggatccctcag
caccggcaatggactgaactcaacagcgcccacctccccgacaaacccagtagcatggag
cagcccacaggcgagagccatgggcccctggacagcctgagggcccccttcaatgagcgc
ctggcggacagcagcacctccgctgggccgcccgccgagcccgccagcaaggaggtcagc
tgcaacgagtgctcagcctccttttccagcctccagacctacatggagcatcactgccct
ggcacgcatcccccgccggccctgcgagaggagagcgccagcgacaccagcgaggagggc
gaggaggagagcgatgtggagaacctggccggggagatcgtctaccagccagacggctcc
gcgtacattgttgagagcctgagccagctggcccagagcggggccgcgtgtggcagcagc
agcggcagcggggctgtcccctcgctcttcctgaactctctcccaggggtgggggggaaa
caaggggacccttcgtgtgctgcacccgtgtacccgcagatcatcaacactttccacata
gcctcatccttcgggaaatggtttgaaggctcagacccggccttcccgaatacctcagcc
ctggcggggctcagccctgtcctgcacagcttccgcgtttttgacgtgcgacacaaaagc
aacaaggattacctgaacagcgatggttctgccaaaagctcctgcgtatccaaagatgtt
cccaacaatgtggacctgtccaaattcgatggctttgtgctctacggcaagaggaaaccc
attttgatgtgtttcctgtgcaaactctcctttgggtatgtgcgttcatttgtgacccac
gcggtgcacgaccatcgaatgaccctgagcgaagaggagcggaaacttcttagcaataag
aacatctccgctatcatccaagggattggcaaagacaaggaaccccttgtaagttttctg
gaaccaaaaaacaaaaactttcaacaccctttagtttccacagctaacctcataggcccc
ggacacagtttttatggtaaatttagtggcattcgcatggaaggggaggaggccctccca
gccgtagccgctgctggccctgagcagccccaggctggtctcttgacccccagcaccctc
ttgaaccttggcgggcttaccagctcggtcctgaagacccccattacctcagtccccctg
gggcctctggcttctagtcctaccaaatcctcagagggcaaggactctggggcagctgaa
ggagataagcaagaatcggggggtcatcaggactgcttctccgagaaagtagagccagcc
gaggaagaggaggcagaagaggaggaagaggaggaggaagaggcggaggaggaggaggaa
gaggaggaggaagaagaggaagaggaagaggagggctgcaaaggactctttccaaatgac
ctggaggaggagctggaggacaggccctccgaggagtctggggcccccgcaggtggtagc
agcaaaaaggaccttgctctctcaaaccaaagcatttctaactcccccttaatgcctaat
gtgctccagaccctgtcgaggggcccagcttctactacttctaactctgcttctaacttt
gttgtctttgatggtgcgaacaggaggagtcgtttaagctttaacagtgagggcgtcagg
gccaacgtggcagagggcaggaggctggacttcgctgacgaaagtgccaataaagacagt
gccacagcaccagaaccaaatgaaagcacagagggcgatgatgggggctttgtccctcat
caccagcacgctggctccctctgcgagcttggggtcggggagtgcccctcaggtagcggt
gtggagtgccccaaatgtgacacggtcctgggctcctcacgctcgctgggcggccacatg
accatgatgcattctcgtaactcgtgtaagacgctcaagtgccccaagtgcaactggcac
tataagtaccagcagacactggaggcgcacatgaaggagaagcacccggagccagggggc
tcctgcgtctactgcaaaagcgggcagccccacccgcgcttggcacgaggcgagagctac
acgtgtggttacaagcctttccgctgcgaggtgtgtaactactccacaactaccaaaggc
aacctcagtattcatatgcagtccgacaaacatctcaacaacatgcagaacctgcagaac
ggagggggcgagcaggtcttcagccacagcgccggggccgcggccgccgccgcagctgca
gcagcggccgccgccaacatcggcagctcctgcggtgccccctcccccaccaaaccaaaa
accaaacccacgtggcggtgtgaggtgtgcgactacgagaccaacgtggccaggaacctc
cgcattcacatgaccagtgagaaacacatgcacaacatgatgctgcttcaacagaacatg
acccagatccagcacaaccgccacctggggctcggcagcctcccctcgcccgctgaggct
gagctctaccagtactacctggcccagaacatgaacctgcccaacctgaagatggacagt
accgcttcggatgcccagttcatgatgagtggattccagctggatcctacagggcccatg
gccgccatgacgcctgctctagtgggcggtgagatccccctcgacatgcgcctcgggggc
gggcagctggtgtcggaggagctgatgaacctgggcgagagcttcatccagaccaacgac
ccatcgctgaagctcttccaatgtgccgtctgcaacaagttcacgacggacaacctggac
atgctggggctgcacatgaacgtggagcgcagcctctcggaggacgagtggaaggccgtg
atgggggactcttaccagtgcaagctctgccgctacaacacgcagctcaaggccaacttc
cagctgcactgcaagacggacaagcacgtgcagaagtaccagctggtggcccacatcaag
gagggtggcaaggccaatgagtggaggctcaagtgtgtggccatcggcaaccctgtgcac
ctgaagtgcaacgcttgtgactactacaccaatagcctggagaagctgcggctgcacaca
gtcaactccaggcacgaggccagcctgaagctgtacaagcacctgcagcagcatgagagt
ggcgtggagggtgagagctgctactaccactgtgtcctgtgcaactactccaccaaggcc
aagctcaacctcatccagcacgtgcgctccatgaagcaccagcgcagtgagagcctgcgc
aagctgcagcggctgcagaagggcctcccggaggaggacgaggacctgggccagatcttc
accatccgcaggtgcccctccactgacccagaggaagccgttgaagatgccgaaggaccc
agcgaagcatctgctgacccagaggagctggccaaagaccaggggagcggcagcgaggaa
gggcagagcaagagggcagcgtcatccagtcaggcagagaaggagttgacggattcccct
gcaaccaccaaacgcacctccttcccgggtagctctgagactccgctctcttcgaagagg
ccaaaagcatcagaggagatcaaacccgagcagatgtaccagtgtccctactgcaagtat
agcaacgctgacgtgaaccggctgcgggtgcacgccatgacacagcactcggtgcagcct
ttgctccgctgtcccctgtgccaagacatgctcaacaacaagatccacctccagctgcac
ctcacccacctccacagcgtggcacctgactgcgtggagaagctcattatgacggtgacc
gctcctgagatggttatgcctagtagcatgttcctccctgctgccgctgcggaccgagat
gggaactccactttggaagaggcaggaaagcaacctgaagcgtcagaggacccgggaaag
aacatcttgccacctgcaagcatggagcacggcggggacctcaagccgacctctgctgac
cccagctgcgggagagaagactcaggcttcctctgctggaagaaggggtgcaaccaggtc
ttcaaaacctccgccacactgcagacccatttcaacgaggtgcacgccaagaggccccag
ctgcccgtgtcagaccgccacgtgtataagtaccgctgcaaccagtgcagcctggctttc
aagaccattgaaaagctgcagctccactctcagtaccacgtgatcagagccgccaccatg
tgctgcctctgtcagcgcagtttccggactttccaggctctgaaaaaacacctcgagacg
agtcacctggagttgagtgaggctgacatccaacagctttatggggggcttctggccaac
ggggacctcttggcgatgggagaccccaccctggctgaagaccacaccatcatcgttgag
gaagacaaggaggaagagagtgacctggaagataagcagagcccgacaggcagcgactct
gggtcagtgcaggaggattcaggctccgagccaaagcgagctctgcctttcaggaaaggc
cccaacttcactatggagaagtttctggacccttcccgcccttacaagtgtacggtctgc
aaggaatccttcactcaaaagaatatcctgctggtgcactacaactccgtctcgcacctg
cacaagttaaagagggcccttcaggaatcggcaaccggccagccggagcccaccagcagc
ccggacaataagccgtttaagtgtaacacttgcaacgtggcgtacagccagagttccacg
ctggagatccacatgcggtctgtgctgcaccagaccaaggcacgggcagccaagctggag
gctgcaagtgggaacagcaacgggactggcaacagcggcggggtgtccctcagctcctct
acccccagtcccgtgggcagcagcggcgccaacaacacctttaccgccaccaatccaagc
agtgccgccatggctccaagcgtcaatgcgctgagccaggtgccacccgagagcgtggtg
atgccgcctctggggaaccccatcagtgccaacatcgcttccccttcagagcccaaagag
gccaaccggaagaagttagcggatatgattgcgtccaggcaacagcagcagcagcagcag
cagcagcagcagcagcaagcccagacactcgcccaggcccaggcgcaagtccaggcacac
ctgcagcaggagctgcagcaacaggccgccctgatccagtctcagctgttcaaccccacg
ctcctcccacacttccccatgaccacagagaccttgctccagctgcagcagcagcagcac
ctcctcttccccttttacatccccagcgctgagttccagctcaaccctgaggtgagcctg
cctgtgaccagcggggcactgacactcacggggtcaggcccaggcctgctggaagatctg
aaggctcaggtccagatcccacagcagagccaccagcagatcctgcagcagcagcagcag
cagagtcagctctctctttcccagagtcattcagccctcctgcagccaagccaacacccg
gaaaagaaaaacaaagtggtcatcaaggaaaaggataaggaaagccagagagagagggag
gggccggagggggcagagggtaacacgggaccaaaggaatcactgccagatgcctcgaag
gccaaagagaagaaagacttggcaccagggggcggctctgagggcactatgcttcctcca
cgcattgcttcagatgccagggggaatgctaccaaggccttgctggagaactttggcttt
gagctcgtcattcagtataatgagaacaagcagaaggcacagaagaagaacgggaaggcg
gagcaaggcggtgaaagcctggagaagctggagtgtgactcctgcggcaagctcttctcc
aacatcttgattctgaagagccaccaggagcacgtgcatcagaactacttccccttcaaa
cagctggagaggtttgccaagcaatacagagagcactatgataaactgtaccccctgagg
ccccagaccccggagccacccccaccccctcctccgcctcccccgcctccgcttcctacc
gcacctccccagccagcttccgcgccagccatccccgcgtcggctccacccatcacttcg
cccaccatcgcccccgcccaaccctccgtgcctctcacccagctctccatgccaatggag
ctgcccatcttctcgccactgatgatgcagacaatgccactgcagactctgccagctcag
ctgccccctcagctcggccccgtggagccgctgcctgccgatctggcccagctctaccaa
caccagctcaaccccaccttgctccagcaacagaacaagaggcctcgcaccaggatcacg
gatgaccagctccgagtgctcaggcagtacttcgacattaacaactcccccagtgaggag
cagatcaaagagatggcggacaagtcgggcctgccccagaaagtgatcaagcactggttc
agaaacactctattcaaggagcggcaacggaacaaggactccccgtacaacttcagcaac
cctcccatcaccagtctggaggaactcaagatcgactcccggcccccttcccccgaaccc
cagaagcaggagtactgggggagcaagcggtcctcgagaacaaggtttaccgactaccag
ctccgagtcctgcaagacttctttgatgccaatgcttacccaaaggatgatgaatttgag
cagctttctaacttactgaaccttccaacccgtgtcatagtggtgtggtttcagaacgcc
cgacagaaagccaggaagaattacgagaatcagggggagggcaaagacggagagcggcgc
gagcttaccaacgatcgctacattcggacgagcaacttgaattaccagtgcaaaaagtgc
agcctcgtgtttcagcgcatctttgacctcatcaaacaccagaagaagctgtgctacaag
gatgaggatgaggaggggcaggatgacagccaaaacgaggactccatggatgccatggag
atcctcacccctaccagctcctcctgcagcacccctatgccctcgcaggcttacagcacc
ccggcaccgtcggcggcagcggccaataccgcgccctccgcgttcttgcagctcacagcg
gagactgatgaactggccaccttcaactcgaaagcagaggcaagcgatgagaagccaaag
caggccgaccctcccagtgcacagccaaaccaaacccaagagaagcaaggacagccaaag
ccagagatgcagcagcagctggagcagctggagcagaagacaaacgcaccccagcccaag
ctcccgcagccggctgccccttccttaccgcagcctcctccgcaggcaccccctccgcag
tgccccctcccccagtcaagccccagtccctcgcagctctcccatctgcccctcaagccc
ctccacacgtcgacccctcaacagctggcaaacctacctcctcagctaatcccctaccag
tgtgaccagtgcaagctggcgttcccatccttcgagcactggcaggagcaccagcagctt
cacttcctgagtgcccagaaccagttcattcacccccagtttttggacaggtcgttggac
atgcctttcatgctgtttgatcccagtaacccactcctggccagccagctgctctcgggt
gccatccctcagatcccagcgagctcagccacttccccttcgacgcccacctccacgatg
aacacgctcaagaggaagctggaggaaaaggccagtgcgagccccggtgagaacgacagc
ggcacgggaggagaagagcctcagagagacaagcgtttgaggacgaccataaccccggag
cagctggaaattctctaccagaagtatctgctggactccaacccgacccgaaagatgctg
gatcacatcgcgcatgaggtgggcttgaagaagcgcgtggtacaggtctggtttcagaac
acccgcgcccgggaaaggaaaggtcagttccgggctgtgggcccggcgcaggcccacagg
aggtgccccttttgccgagctctcttcaaggccaagacagccctggaggctcatatccgg
tctcgacactggcacgaagccaagagagccggctacaacctgactctgtctgccatgctc
ttagactgtgatgggggactccaaatgaagggagacatttttgatggaactagcttttcc
cacctacccccgagcagtagtgacggtcagggtgtgcccctctcgcccgtgagcaaaacc
atggagctgtcccccagaactcttctcagcccttcctccatcaaggtggaagggatcgaa
gactttgaaagcccctccatgtcctccgttaacctgaactttgaccaaactaagctggac
aatgatgactgttcctcggtcaacaccgcaatcacagacaccacgacaggggacgagggc
aacgccgacaacgacagcgcaacaggaatagcgactgaaaccaaatcttcggcaccgaac
gaggggttgaccaaagcagccatgatggcaatgtccgagtatgaagaccggttgtcatct
ggtctggtcagcccagccccgagcttttatagcaaggaatatgacaacgaaggtacagtg
gactacagtgaaacctcaagcctcgcggacccctgctccccaagccccggggcaagcggg
tccgctggcaaatctggtgacggcggggatcgacctgggcagaaacgttttcgcactcaa
atgaccaatctgcagctgaaggtcctcaagtcatgctttaatgactacaggacacccacc
atgctggagtgtgaggttctaggcaatgacattggattgccaaagagagttgttcaggtc
tggttccagaatgcccgggcgaaagagaagaagtccaagttaagcatggccaagcatttt
gggataaaccaaacgagttatgagggacccaagaccgagtgcactttgtgtggcatcaag
tacagcgcgaggctgtctgtacgtgaccatatcttttctcaacagcatatctccaaagtt
aaggacaccattggaagccagctggacaaggagaaagaatattttgacccagccactgta
cgccagttgatggctcagcaagagctggaccggatcaagaaggctaacgaggtcctcgga
ctggcagctcaacaacaagggatgttcgacaacgcccctcttcaggctcttaaccttcct
accacgtatccagcgctccagggcatccctcctgtgttgctccccggcctcaacagcccc
tctctgccaggctttaccccagccaacacagctttaacgtctcctaaaccgaacctgatg
ggtctgcccagcacaacggtaccttcccccggcctccccacatctggattaccaaataaa
ccgtcctcagcctcgctgagttccccgaccccagcacaagccaccatggcaatggcccct
cagccacccccacaaccccagcagccgcagccaccggtgcagcagcctccgccgccgcca
gcagcccaacagatccctgcaccacagctgaccccgcagcagcaacgtaaggacaaagat
ggtgagaaaggaaaggagaaggaaaaggcacacaaagggaagggggagcccctccccgtc
cccaagaaggagaaaggagaggcccctccagcggctacagcaaccatctcagccccactg
cccgccatggagtacgcagtggaccctgctcagcttcaggccctacaggcggccttgact
tcagaccccacagctttgctcacgagccagttccttccttactttgtaccgggcttttct
ccttattatgccccccagatccctggcgccctgcagagtgggtacctgcagcccatgtat
ggcatggaaggcctgtttccctacagccctgccctatcgcaggccctgatgggcttgtct
ccaggctccctactgcagcagtaccagcaataccagcagagtctgcaggaggcgattcag
cagcagcagcagcagcagcaacagcaacagcagcagcaacagcggcaactacagcaacag
cagcagcaacagcaacaaaaagtacagcagcagcagcagcagcagcagcagcccaaagca
agccaaaccccagtcccccaggggcctgcttccccagacaaagaccctgccaaagaatcc
cccaaaccagaagagcagaaaaacgtcccccgtgaggtgtcccccctcctgccgaaaccc
cccgaagagccagaagcagaaagcaaaagtgcaagtgcggactccctctgtgaccccttc
attgttccaaaggtgcagtacaagttggtctgccgcaagtgccaggcgggcttcggcgac
gaggaggcggcgaggagccacctgaagtccctctgctgcttcggccagtctgtggtgaac
ctgcaagagatggtgcttcatgtccccaccggcagcggtggcagcggcggtggcggtggt
ggcagcggtggcggaggcggctcgtaccactgcctggcgtgcgagagcgcgctctgcggg
gaggaagcgctgagtcagcatctcgagtcggccttgcacaaacacagaacaatcacgaga
gcagcaagaaacgccaaagagcaccctagtttattacctcactctgcctgcttccccgat
cctagcaccgcatctacctcgcagtctgccgctcactcaaacgacagcccccctcccccg
tcggccgccccgtcctcgtccgcttccccccacgcctccaggaagtcttggccgccagtg
ggctcccgggcttcggccgcgaagcccccttcttttcctcctctctcctcatcttcaacg
gttacctcaagttcatgcagcacctcaggggttcagccctcgatgccaacagacgactat
tcggaggagtctgacacggatctcagccaaaagtccgacggaccggcgagcccggtggag
ggtcccaaagaccccagctgccccaaggacagtggtctgaccagtgtaggaacggacacc
ttcagattgtaa

DBGET integrated database retrieval system