KEGG   Mus musculus (mouse): 11909
Entry
11909             CDS       T01002                                 

Gene name
Atf2, ATF-, Atf-2, CRE-, CRE-BP, Creb, Creb2, D130078H02Rik, D18875, Tg(Gzma-Klra1)7Wum, mXB, mXBP
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11909 (Atf2)
   04668 TNF signaling pathway
    11909 (Atf2)
   04022 cGMP-PKG signaling pathway
    11909 (Atf2)
   04151 PI3K-Akt signaling pathway
    11909 (Atf2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11909 (Atf2)
   04922 Glucagon signaling pathway
    11909 (Atf2)
   04915 Estrogen signaling pathway
    11909 (Atf2)
   04926 Relaxin signaling pathway
    11909 (Atf2)
   04935 Growth hormone synthesis, secretion and action
    11909 (Atf2)
   04918 Thyroid hormone synthesis
    11909 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    11909 (Atf2)
   04925 Aldosterone synthesis and secretion
    11909 (Atf2)
   04927 Cortisol synthesis and secretion
    11909 (Atf2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11909 (Atf2)
  09156 Nervous system
   04728 Dopaminergic synapse
    11909 (Atf2)
  09149 Aging
   04211 Longevity regulating pathway
    11909 (Atf2)
  09159 Environmental adaptation
   04714 Thermogenesis
    11909 (Atf2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11909 (Atf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    11909 (Atf2)
  09165 Substance dependence
   05030 Cocaine addiction
    11909 (Atf2)
   05031 Amphetamine addiction
    11909 (Atf2)
   05034 Alcoholism
    11909 (Atf2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11909 (Atf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11909 (Atf2)
   05161 Hepatitis B
    11909 (Atf2)
   05163 Human cytomegalovirus infection
    11909 (Atf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11909 (Atf2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11909 (Atf2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 11909
NCBI-ProteinID: NP_001020264
MGI: 109349
Ensembl: ENSMUSG00000027104
Vega: OTTMUSG00000013179
UniProt: P16951 Q543G2 Q640L6 Q68FE3
LinkDB
Position
2; 2 C3
AA seq 487 aa
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPS
QAQPSGS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacgccaacaagattcctaaaaaac
tgtgaagaagtgggtttgttcaatgagttggcaagtccatttgaaaatgaattcaagaag
gcttccgaagatgacattaaaaaaatgcctctagatttgtcccctcttgcaacacccatc
ataagaagcaaaattgaggagccttctgttgtagaaacaactcaccaggacagcccttta
cctcaccccgagtcgactaccagtgatgaaaaggaagtaccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctc
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccagtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatactgtaaaaggccat
ggcagtggattggttaggactcagtcagaagagtctcgcccacagtccttgcagcagcca
gccacctccactacagaaactccggcttctccagctcacacaactcctcagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtgtgggttcag
tccttagagaagaaagcagaagacttgagttcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcccagctgaaacagcttcttctggctcataaagattgc
cctgtaactgccatgcagaagaagtctggctatcatactgctgataaagatgacagttca
gaagacctttctgtgccaagcagtccacatacagaagcgatccagcacagctctgtcagc
acatccaatggagtcagttcaacatcaaaagcagaagctgtagccacttcagtcctcacc
cagatggcggaccagagcacggagcctgcactttcacagattgtcatggctcctccctcc
caggcacagccctcaggaagttga

KEGG   Mus musculus (mouse): 11911
Entry
11911             CDS       T01002                                 

Gene name
Atf4, Atf-, Atf-4, C/AT, C/ATF, CREB, CREB-2, CREB2, TAXREB, TAXREB67
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04137  Mitophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04932  Non-alcoholic fatty liver disease
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    11911 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11911 (Atf4)
   04668 TNF signaling pathway
    11911 (Atf4)
   04022 cGMP-PKG signaling pathway
    11911 (Atf4)
   04151 PI3K-Akt signaling pathway
    11911 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    11911 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    11911 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11911 (Atf4)
   04922 Glucagon signaling pathway
    11911 (Atf4)
   04912 GnRH signaling pathway
    11911 (Atf4)
   04915 Estrogen signaling pathway
    11911 (Atf4)
   04926 Relaxin signaling pathway
    11911 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    11911 (Atf4)
   04918 Thyroid hormone synthesis
    11911 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    11911 (Atf4)
   04925 Aldosterone synthesis and secretion
    11911 (Atf4)
   04927 Cortisol synthesis and secretion
    11911 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11911 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    11911 (Atf4)
   04728 Dopaminergic synapse
    11911 (Atf4)
   04720 Long-term potentiation
    11911 (Atf4)
   04722 Neurotrophin signaling pathway
    11911 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    11911 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11911 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    11911 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11911 (Atf4)
   05012 Parkinson disease
    11911 (Atf4)
   05014 Amyotrophic lateral sclerosis
    11911 (Atf4)
   05020 Prion disease
    11911 (Atf4)
   05022 Pathways of neurodegeneration - multiple diseases
    11911 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    11911 (Atf4)
   05031 Amphetamine addiction
    11911 (Atf4)
   05034 Alcoholism
    11911 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    11911 (Atf4)
   04934 Cushing syndrome
    11911 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11911 (Atf4)
   05161 Hepatitis B
    11911 (Atf4)
   05163 Human cytomegalovirus infection
    11911 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11911 (Atf4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11911 (Atf4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF4795 Fez1 Laminin_II DUF3450 AAA_13
Other DBs
NCBI-GeneID: 11911
NCBI-ProteinID: NP_001274109
MGI: 88096
Ensembl: ENSMUSG00000042406
UniProt: Q06507 Q8CF69
LinkDB
Position
15 E1; 15 37.85 cM
AA seq 349 aa
MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
AMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCD
LFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLE
LGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRA
PPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAE
QEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaagtgttggcgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactatctggaggtg
gccaagcacttgaaacctcatgggttctccagcgacaaggcgggctcctcggaatggccg
gctatggatgatggcttggccagtgcctcagacaccggcaaggaggatgccttttccggg
acagattggatgttggagaaaatggatctgaaagagtttgacttcgatgctctgtttcga
atggatgacctggaaaccatgccagatgagctcttgaccacgttggatgacacatgtgat
ctttttgcccctctagtccaagagactaataaggagccccctcagacagtgaacccaatt
ggccatctcccagaaagtttaataaaagtcgaccaggttgccccctttacattcttgcag
cctttcccctgttccccaggggttctgtcttccactccagagcattcctttagtttagag
ctaggcagtgaagttgatatctctgaaggagacaggaagcctgactctgctgcttacatt
actctaatccctccatgtgtaaaggaggaagacactccctctgacaatgacagtggcatc
tgtatgagcccagagtcctacctgggctctccccagcatagcccctccacctccagggcc
ccaccagacaatctgccttctccaggtggttcccgtgggtctcctcggcccaaaccttat
gacccacctggagttagtttgacagctaaagtgaagactgagaaattggataagaagctg
aaaaagatggagcaaaacaagacagcagccactaggtaccgccagaagaagcgggctgag
caggaggccctcactggcgagtgtaaggagctagaaaaaaagaatgaggctctgaaagag
aaggcagattctctggccaaggagatccagtatctgaaagacctgatagaagaggtccgt
aaggcaagggggaagaagagagttccgtaa

KEGG   Mus musculus (mouse): 12912
Entry
12912             CDS       T01002                                 

Gene name
Creb1, 2310001E10Rik, 3526402H21Rik, AV083133, Cre, Creb, Creb-, Creb-1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04380  Osteoclast differentiation
mmu04612  Antigen processing and presentation
mmu04668  TNF signaling pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12912 (Creb1)
   04024 cAMP signaling pathway
    12912 (Creb1)
   04022 cGMP-PKG signaling pathway
    12912 (Creb1)
   04151 PI3K-Akt signaling pathway
    12912 (Creb1)
   04152 AMPK signaling pathway
    12912 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12912 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    12912 (Creb1)
   04922 Glucagon signaling pathway
    12912 (Creb1)
   04915 Estrogen signaling pathway
    12912 (Creb1)
   04926 Relaxin signaling pathway
    12912 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    12912 (Creb1)
   04918 Thyroid hormone synthesis
    12912 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    12912 (Creb1)
   04916 Melanogenesis
    12912 (Creb1)
   04924 Renin secretion
    12912 (Creb1)
   04925 Aldosterone synthesis and secretion
    12912 (Creb1)
   04927 Cortisol synthesis and secretion
    12912 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12912 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    12912 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    12912 (Creb1)
   04728 Dopaminergic synapse
    12912 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12912 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    12912 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    12912 (Creb1)
   04713 Circadian entrainment
    12912 (Creb1)
   04714 Thermogenesis
    12912 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12912 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    12912 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    12912 (Creb1)
   05020 Prion disease
    12912 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    12912 (Creb1)
   05031 Amphetamine addiction
    12912 (Creb1)
   05034 Alcoholism
    12912 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    12912 (Creb1)
   04934 Cushing syndrome
    12912 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12912 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12912 (Creb1)
   05161 Hepatitis B
    12912 (Creb1)
   05163 Human cytomegalovirus infection
    12912 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12912 (Creb1)
   05165 Human papillomavirus infection
    12912 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12912 (Creb1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12912 (Creb1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    12912 (Creb1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    12912 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 12912
NCBI-ProteinID: NP_598589
MGI: 88494
Ensembl: ENSMUSG00000025958
Vega: OTTMUSG00000047617
UniProt: Q01147 Q543W0
LinkDB
Position
1 C2; 1 32.74 cM
AA seq 327 aa
MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaaatcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcaacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcggcccagccatcagttatccagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aagtcagaagaggagacttcagcccctgccatcaccactgtaacagtgccaacccccatt
taccaaactagcagtgggcagtacattgccattacccagggaggagcaatacagctggct
aacaatggtacggatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacagtatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctcaggcgatgtacaaacataccagatc
cgcacagcacccacgagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacacagcctgctgaagaagcagcacggaagagagaggtccgtctaatgaagaacagg
gaggcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaaccaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

KEGG   Mus musculus (mouse): 12913
Entry
12913             CDS       T01002                                 

Gene name
Creb3, AU044960, AW538053, C80076, L, LZI, LZIP, LZIP-1, LZIP-2, Lu, Luman
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12913 (Creb3)
   04024 cAMP signaling pathway
    12913 (Creb3)
   04022 cGMP-PKG signaling pathway
    12913 (Creb3)
   04151 PI3K-Akt signaling pathway
    12913 (Creb3)
   04152 AMPK signaling pathway
    12913 (Creb3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12913 (Creb3)
   04922 Glucagon signaling pathway
    12913 (Creb3)
   04915 Estrogen signaling pathway
    12913 (Creb3)
   04926 Relaxin signaling pathway
    12913 (Creb3)
   04935 Growth hormone synthesis, secretion and action
    12913 (Creb3)
   04918 Thyroid hormone synthesis
    12913 (Creb3)
   04928 Parathyroid hormone synthesis, secretion and action
    12913 (Creb3)
   04916 Melanogenesis
    12913 (Creb3)
   04925 Aldosterone synthesis and secretion
    12913 (Creb3)
   04927 Cortisol synthesis and secretion
    12913 (Creb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12913 (Creb3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    12913 (Creb3)
  09156 Nervous system
   04725 Cholinergic synapse
    12913 (Creb3)
   04728 Dopaminergic synapse
    12913 (Creb3)
  09149 Aging
   04211 Longevity regulating pathway
    12913 (Creb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    12913 (Creb3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12913 (Creb3)
  09162 Cancer: specific types
   05215 Prostate cancer
    12913 (Creb3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    12913 (Creb3)
   05020 Prion disease
    12913 (Creb3)
  09165 Substance dependence
   05030 Cocaine addiction
    12913 (Creb3)
   05031 Amphetamine addiction
    12913 (Creb3)
   05034 Alcoholism
    12913 (Creb3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    12913 (Creb3)
   04934 Cushing syndrome
    12913 (Creb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12913 (Creb3)
   05161 Hepatitis B
    12913 (Creb3)
   05163 Human cytomegalovirus infection
    12913 (Creb3)
   05165 Human papillomavirus infection
    12913 (Creb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12913 (Creb3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    12913 (Creb3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF2721
Other DBs
NCBI-GeneID: 12913
NCBI-ProteinID: NP_038525
MGI: 99946
Ensembl: ENSMUSG00000028466
Vega: OTTMUSG00000006960
UniProt: Q3UNH6
LinkDB
Position
4 A5; 4 23.05 cM
AA seq 379 aa
MDPGGQDLLALDPGDQDLLGFLLEESGDLWAATEPDVKAPLDLELSPSENSVQELSDWEV
EDLLSSLLSPSVSRDVLGSSSSSILHDHNYSLPQEHVSIDLDTESFEKEGFHVTPLPGEE
RAAEQEMSRLILTEEEKKLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKK
KKVYVVGLESRVLKYTAQNRELQNKVQRLEEQNLSLLDQLRKLQAMVIEIANKTSSGSTC
VLVLVFSFCLLLVPAMYSSDARGSVPAEYVVLHRKLRALPSEDDHQPKPSALSSELPMDS
THQSLDSSEHMFLVSSNFSCVLYHAPQAEQPLHWPLWDLSSEMLFSDSNLLLQANLSESE
GWQPNHSPSLVIFQGRYSG
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggatcctggtggtcaggatctgctagctttggatcccggtgatcaggacctgctgggc
ttcctgctagaggaaagcggagatttgtgggctgcgactgagccggacgtgaaggctccg
ctggacttagagctgtcaccttccgagaactccgtgcaagaactgagcgactgggaggta
gaggatttactgagctctctgctcagtccctcagtatcgcgggatgttctcggctcttcc
agctcttccattctccatgatcacaactactcccttccacaggagcacgtctccatagat
ctagatactgagagcttcgaaaaggaggggttccacgtgactccactgccaggggaggaa
agagcagcggaacaggagatgtctaggctgatactgaccgaggaagagaagaagctcttg
gagaaggaggggctcactctgccctcaacccttcctctcactaaggtggaggaacaagtt
ctgaaacgagtgcggaggaagattcgtaacaagagagcagctcaagaaagccgcaagaag
aagaaggtgtatgtcgtggggctggagagcagggtcttgaaatacacagctcagaatcgg
gagctgcagaacaaggtgcagcgtttggaggaacagaatctgtcccttctagatcaactg
aggaagcttcaagccatggtgattgagatagccaacaaaaccagcagcggcagcacttgt
gttctggtcctcgtgttctccttctgtcttctcctggtacccgctatgtactcctctgat
gcaaggggaagtgtgcccgcggagtatgttgtgttgcaccgcaagcttcgtgccctcccc
agcgaggacgatcatcagccgaagccatctgctctatcgtcagagctacccatggacagc
acacaccagtcactggacagctcagaacatatgttcttggtctccagcaacttttcctgt
gtactgtaccacgcgcctcaggcagagcagcccctgcactggccactctgggatctttct
tcagagatgctcttctccgactccaaccttctcctgcaggcaaacctttcagaaagcgag
ggatggcaacctaaccacagcccttctttggtcatctttcagggcaggtattcaggttag

KEGG   Mus musculus (mouse): 12915
Entry
12915             CDS       T01002                                 

Gene name
Atf6b, AA617266, ATF6be, ATF6beta, Creb, Creb-rp, Crebl1
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12915 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12915 (Atf6b)
   04022 cGMP-PKG signaling pathway
    12915 (Atf6b)
   04151 PI3K-Akt signaling pathway
    12915 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12915 (Atf6b)
   04915 Estrogen signaling pathway
    12915 (Atf6b)
   04926 Relaxin signaling pathway
    12915 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    12915 (Atf6b)
   04918 Thyroid hormone synthesis
    12915 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    12915 (Atf6b)
   04925 Aldosterone synthesis and secretion
    12915 (Atf6b)
   04927 Cortisol synthesis and secretion
    12915 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12915 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    12915 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    12915 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12915 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    12915 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    12915 (Atf6b)
   05031 Amphetamine addiction
    12915 (Atf6b)
   05034 Alcoholism
    12915 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12915 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12915 (Atf6b)
   05161 Hepatitis B
    12915 (Atf6b)
   05163 Human cytomegalovirus infection
    12915 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12915 (Atf6b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    12915 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB Docking
Other DBs
NCBI-GeneID: 12915
NCBI-ProteinID: NP_059102
MGI: 105121
Ensembl: ENSMUSG00000015461
Vega: OTTMUSG00000037081
UniProt: Q3UJ07 A0A0A0MQ69
LinkDB
Position
17 B1; 17 18.22 cM
AA seq 706 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAQLFRCVEQDV
PFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQVP
GVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSASDDLSDIQTKLEPASPSSSVHS
EASLLSADSPSQPFIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKA
PATRKPPLQPKPVVLTTVPVPPRAGPTSAAVLLQPLVQQPAVSPVVLIQGAIRVQPEGPA
PAAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQAVLADNQQLRRENAALRRRLEALLAENSGLKLGSGNRKVVCIMVFLLFIAFNFGPVSI
SEPPPAPMSPRMSREEPRPQRHLLGFSEPGPAHGMEPLREAAQSPGEQQPSSAGRPSFRN
LTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPHRAQE
RQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPSPGNTTGGPLPGSAASPAHQASQPLYLNHP
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctcagtgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagtccggaggactgggacagcaccttgtacagt
ggcctggatgaagtggccgaggagcaggcacagttgttccgttgcgtggagcaggatgtc
ccgtttgacagcagctctctggatgtggggatggatgtcagcccccctgagcccccttgg
gaccctctacccatcttcccagatcttcaggtgaagtccgagccatcctctccctgctcg
tcctcctccctcagctcagagtcctcacatctttccacagagccccccagccaggtccct
ggtgtaggcgaggtgctgcatgtgaagatggagtccctggcacccccactctgcctgctg
ggggatgatccagcatccccctttgaaacggtccagatcactgtgggctctgcctctgat
gatctttcagatatccagaccaagctggaacctgcctctccgtcttcttctgtccactct
gaggcctccttgctgtcagcagactctcccagtcagccttttataggagaggaggttctg
gaagtgaagacagagtctccgtcccctccagggtgcctcctgtgggatgtcccagcctct
tcgctcggagctgtccagatcagcatgggtccatcccctgatagttcctcagggaaagct
ccggccactcggaagcctccactgcagcccaagcctgtggtactaaccacagttccggtg
ccacctagagctgggcctaccagcgctgccgtcctcctgcaacccctggtccagcagcct
gcggtgtccccagtggtcctcatccaaggtgctatccgagtccagcctgaagggccagct
cccgcagctccccggcctgagaggaagagcattgttccagcccctatgccggggaactcc
tgcccgcctgaagtggatgcaaagctgttgaagcggcagcagcggatgatcaagaatcga
gagtcggcctgccagtcccgccgcaagaagaaagagtacctgcaaggcctggaggcccgg
ctgcaggctgtgctggccgacaaccagcagctgcgcagggagaacgctgccctccggcgg
cggctggaggccctgctggcagagaacagcgggctcaagctggggtctggaaacaggaag
gttgtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtgagcatc
agcgagccgcctccagctcccatgtctcctcggatgagcagggaggaacctcgaccccag
aggcacctgctgggcttctcagaaccagggccagctcatggcatggaaccccttcgggaa
gccgcccagagccccggggagcagcagcccagctctgcaggcaggcccagcttcagaaac
ctgacggccttccccgggggagccaaggagctgctgctgagagacctggaccagctcttc
ctctcctcagactgtcgccatttcaaccgaactgagtctctgaggcttgctgatgagctg
agtggctgggtccaacgtcaccagagaggtcgacggaagatacctcacagggcccaggag
agacagaagtctcagctacggaagaagtctcctccagtgaaacctgtccccacccaacct
ccaggaccccctgaaagggaccccgtgggccagctgcagctctaccgccaccccggccgc
tcgcagccggagtttctagacgcaattgaccggagggaggataccttctatgttgtctcc
ttccgaagggaccacctgctgctcccagccatcagccacaacaagacatccaggcccaag
atgtcgctggtgatgccagccatggcccccaatgagaccgtgtcaggccggggcccccca
ggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcac
atcaagacctctacggtgcccccctcgctccggaagcagccgtccccatccccgggcaat
accacaggtggccccttgccaggctccgcagctagtcctgcccatcaggcctcccagccc
ctctacctcaatcacccctga

KEGG   Mus musculus (mouse): 208647
Entry
208647            CDS       T01002                                 

Gene name
Creb3l2, BBF2H7, C530025K05Rik, SCIRR69
Definition
(RefSeq) cAMP responsive element binding protein 3-like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    208647 (Creb3l2)
   04024 cAMP signaling pathway
    208647 (Creb3l2)
   04022 cGMP-PKG signaling pathway
    208647 (Creb3l2)
   04151 PI3K-Akt signaling pathway
    208647 (Creb3l2)
   04152 AMPK signaling pathway
    208647 (Creb3l2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    208647 (Creb3l2)
   04922 Glucagon signaling pathway
    208647 (Creb3l2)
   04915 Estrogen signaling pathway
    208647 (Creb3l2)
   04926 Relaxin signaling pathway
    208647 (Creb3l2)
   04935 Growth hormone synthesis, secretion and action
    208647 (Creb3l2)
   04918 Thyroid hormone synthesis
    208647 (Creb3l2)
   04928 Parathyroid hormone synthesis, secretion and action
    208647 (Creb3l2)
   04916 Melanogenesis
    208647 (Creb3l2)
   04925 Aldosterone synthesis and secretion
    208647 (Creb3l2)
   04927 Cortisol synthesis and secretion
    208647 (Creb3l2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    208647 (Creb3l2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    208647 (Creb3l2)
  09156 Nervous system
   04725 Cholinergic synapse
    208647 (Creb3l2)
   04728 Dopaminergic synapse
    208647 (Creb3l2)
  09149 Aging
   04211 Longevity regulating pathway
    208647 (Creb3l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    208647 (Creb3l2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    208647 (Creb3l2)
  09162 Cancer: specific types
   05215 Prostate cancer
    208647 (Creb3l2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    208647 (Creb3l2)
   05020 Prion disease
    208647 (Creb3l2)
  09165 Substance dependence
   05030 Cocaine addiction
    208647 (Creb3l2)
   05031 Amphetamine addiction
    208647 (Creb3l2)
   05034 Alcoholism
    208647 (Creb3l2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    208647 (Creb3l2)
   04934 Cushing syndrome
    208647 (Creb3l2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    208647 (Creb3l2)
   05161 Hepatitis B
    208647 (Creb3l2)
   05163 Human cytomegalovirus infection
    208647 (Creb3l2)
   05165 Human papillomavirus infection
    208647 (Creb3l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    208647 (Creb3l2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    208647 (Creb3l2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 208647
NCBI-ProteinID: NP_848776
MGI: 2442695
Ensembl: ENSMUSG00000038648
Vega: OTTMUSG00000023205
UniProt: Q8BH52
LinkDB
Position
6; 6 B1
AA seq 521 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLSDPFLSEK
SESMEVEPSPTSPAPLIQAEHSYSLSEEPRTQSPFTHAATSDSFNDEEVESEKWYLSTEF
PSATIKTEPITEEQPPGLVPSVTLTITAISTPFEKEESPLDMNAGGDSSCQTLIPKIKLE
PHEVDQFLNFSPKEASVDQLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLSQAHSPARAMP
RGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHPLSEPYT
ASVVRSRNLLIYEEHAPLEESSSPASAGELGGWDRGSSLLRASSGLEALPEVDLPHFLIS
NETSLEKSVLLELQQHLVSSKLEGNETLKVVELERRVNATF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggagagactgaggccctcatgtaccacacgcacttctcggagctccta
gacgagttttcccagaacgtcctgggtcagctcctgagtgaccctttcctctcagagaag
agcgagtcaatggaggtggagccatctccaacatcaccagcgcctctcatccaggctgaa
cacagctactctctgagcgaggagccccggactcagtcaccatttacccatgcggctacc
agcgacagcttcaatgacgaggaggtggagagtgaaaaatggtacctgtctacagagttt
ccttcagctaccatcaagacagagccaatcacagaggagcagcccccgggacttgtccct
tctgtcactctgaccatcacagccatttccactccttttgaaaaagaagagtcccctctg
gatatgaatgctgggggggactcctcatgccagacgcttattcctaagattaagctggag
ccgcacgaagtggatcagttcttaaacttctccccgaaagaagcctccgtggatcaactg
cacttaccaccaacaccacccagtagtcacagcagtgactctgagggcagcttgagcccc
aacccacgcctgcatcccttcagcctgtctcaggcccacagccctgccagagccatgccc
cggggcccctctgccttgtccacatctcctctcctcacagctccacataagctgcaggga
tcgggccccctggtcctgacagaagaggagaagaggaccctggttgccgagggctatccc
attcccaccaagctgcctctgacaaaatctgaggagaaggccctgaagaaaatccggaga
aagatcaagaataagatttctgcccaagaaagcaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggtg
gaggtgctggagaacaccaataggactctccttcagcaacttcagaagcttcagactttg
gtgatggggaaggtctctcgaacctgcaagttagctggcacacagactggcacctgcctc
atggtcgttgtgctttgctttgctgttgcatttggaagcttctttcaaggctatgggcct
tatccttctgccaccaagatggctctgcccagccagcatcctctgtcagagccatacaca
gcctccgtggtgagatccaggaacctgctaatctatgaggaacacgctcccctggaagag
tcgtcgagcccagcctcagccggggagctggggggctgggacagaggctcctctctgctc
agggcatcgtcggggcttgaggccctgccagaggtggatcttccccatttccttatctcc
aatgagacgagcttggagaagtcagtactgttggagcttcagcagcacctggtcagcagc
aaactggaagggaacgaaacactcaaggttgtagagctggagaggagagtgaacgccacc
ttctga

KEGG   Mus musculus (mouse): 208677
Entry
208677            CDS       T01002                                 

Gene name
Creb3l3, BC010786, CREB-, CREB-H, D10Bur1, D10Bur1e
Definition
(RefSeq) cAMP responsive element binding protein 3-like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    208677 (Creb3l3)
   04024 cAMP signaling pathway
    208677 (Creb3l3)
   04022 cGMP-PKG signaling pathway
    208677 (Creb3l3)
   04151 PI3K-Akt signaling pathway
    208677 (Creb3l3)
   04152 AMPK signaling pathway
    208677 (Creb3l3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    208677 (Creb3l3)
   04922 Glucagon signaling pathway
    208677 (Creb3l3)
   04915 Estrogen signaling pathway
    208677 (Creb3l3)
   04926 Relaxin signaling pathway
    208677 (Creb3l3)
   04935 Growth hormone synthesis, secretion and action
    208677 (Creb3l3)
   04918 Thyroid hormone synthesis
    208677 (Creb3l3)
   04928 Parathyroid hormone synthesis, secretion and action
    208677 (Creb3l3)
   04916 Melanogenesis
    208677 (Creb3l3)
   04925 Aldosterone synthesis and secretion
    208677 (Creb3l3)
   04927 Cortisol synthesis and secretion
    208677 (Creb3l3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    208677 (Creb3l3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    208677 (Creb3l3)
  09156 Nervous system
   04725 Cholinergic synapse
    208677 (Creb3l3)
   04728 Dopaminergic synapse
    208677 (Creb3l3)
  09149 Aging
   04211 Longevity regulating pathway
    208677 (Creb3l3)
  09159 Environmental adaptation
   04714 Thermogenesis
    208677 (Creb3l3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    208677 (Creb3l3)
  09162 Cancer: specific types
   05215 Prostate cancer
    208677 (Creb3l3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    208677 (Creb3l3)
   05020 Prion disease
    208677 (Creb3l3)
  09165 Substance dependence
   05030 Cocaine addiction
    208677 (Creb3l3)
   05031 Amphetamine addiction
    208677 (Creb3l3)
   05034 Alcoholism
    208677 (Creb3l3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    208677 (Creb3l3)
   04934 Cushing syndrome
    208677 (Creb3l3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    208677 (Creb3l3)
   05161 Hepatitis B
    208677 (Creb3l3)
   05163 Human cytomegalovirus infection
    208677 (Creb3l3)
   05165 Human papillomavirus infection
    208677 (Creb3l3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    208677 (Creb3l3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    208677 (Creb3l3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Spc29 DUF724 ADIP DUF1664
Other DBs
NCBI-GeneID: 208677
NCBI-ProteinID: NP_663340
MGI: 2384786
Ensembl: ENSMUSG00000035041
Vega: OTTMUSG00000030302
UniProt: Q91XE9
LinkDB
Position
10 C1; 10 39.72 cM
AA seq 479 aa
MDGDIAAGKMASPVCAMAPLDSMEVLDLLFDRQDGILRNVELAEGWILAREEQKVLLNSD
SDEFLNCILGPGDSDPSSPLWSPADSDSGISEDLPSDPQDTPPRSGTEPANTVARCHTRE
QGKGPCPSYLPSTPCPEPPRTQVQESSVAIDLDMWSTDTLYPEEPAGSPSRFNLTVKELL
LSGGSGDLQQHSLAASQLLGPGSGHCQELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
HLQALVVQSTSKPAHAGTCIAVLLLSFALIILPSISPFNSNKVDSPGDFVPVRVFSRTLH
NHAASRVAPDVTPGSEVPGPWPDVGTPHKGPSSGGLSADWGNFLEIPMLDNLTEELDNST
LVLANSTEDLGRATLLDWVASEPLLSPGRVGLEIPGEMWLSWVPRWLRVRLVQDALGVL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatggggacatagcggctggaaagatggcgtcccctgtctgtgctatggcgcccttg
gacagcatggaggtccttgacctcctgtttgatcggcaggacggcatcctgagaaacgtg
gagctggccgagggctggatcctcgccagagaggagcagaaagttctactaaattctgat
tctgatgaattcctaaattgcatcctgggacctggagactctgaccccagctctccatta
tggtcccccgctgacagtgacagtggcatctctgaggatctaccttcagacccccaggac
acccctcctcgtagtggcactgaaccagccaacacggtagccaggtgtcacaccagggag
caaggcaaggggccctgcccctcctatctgcccagcaccccatgccctgagcctccaagg
acacaagtccaggagtcctcagtggccattgacctggacatgtggagcacagataccctg
tacccggaggagccggctggctcgccctcccgcttcaacctcactgtgaaggaactgctg
ctgtccggtggcagcggggacttgcaacagcattccttggctgcctcccagctgctggga
cctgggagtgggcactgccaggagctggtgctgacagaggatgagaagaagctgctggct
aaagagggggtgaccctccccacccagctgcctctcaccaagtatgaggaacgagttttg
aaaaaaatccgcagaaagatccggaacaaacagtcagctcaagaaagcaggaagaagaaa
aaagaatacattgatggtctggagaaccggatgtcagcgtgtactgcccagaaccaggag
ctgcagaggaaggttttgcatttagaaaagcaaaatttgtctcttctggagcagctgaaa
cacctgcaggcacttgtggtccagtcaaccagcaagccagcccatgcaggcacctgcata
gcggtccttctgctgtccttcgccctgatcatcctcccctccatcagccctttcaactcc
aacaaagttgacagccctggagacttcgtgccagtgcgagtgttttccagaaccctccac
aaccacgctgcatcccgcgtggctcccgatgtcaccccaggatctgaggtcccaggacct
tggcccgacgttggtaccccccacaaaggcccttcctccggtggtctcagtgcagactgg
ggaaattttctggaaattccaatgttggacaacctgacagaagagctagacaactccacc
ctggtgctggccaactccacagaggacctgggacgggccaccctgctggactgggtggct
tcagaaccactgctcagtccaggccgggttgggctggagataccaggggagatgtggctg
tcctgggtaccaaggtggcttagggtccgtctggtgcaagatgcattgggggtgctgtga

KEGG   Mus musculus (mouse): 231991
Entry
231991            CDS       T01002                                 

Gene name
Creb5, 9430076C15Rik, CRE-BPa, Cre, Crebpa, D430026C09Rik
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    231991 (Creb5)
   04024 cAMP signaling pathway
    231991 (Creb5)
   04022 cGMP-PKG signaling pathway
    231991 (Creb5)
   04151 PI3K-Akt signaling pathway
    231991 (Creb5)
   04152 AMPK signaling pathway
    231991 (Creb5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    231991 (Creb5)
   04922 Glucagon signaling pathway
    231991 (Creb5)
   04915 Estrogen signaling pathway
    231991 (Creb5)
   04926 Relaxin signaling pathway
    231991 (Creb5)
   04935 Growth hormone synthesis, secretion and action
    231991 (Creb5)
   04918 Thyroid hormone synthesis
    231991 (Creb5)
   04928 Parathyroid hormone synthesis, secretion and action
    231991 (Creb5)
   04925 Aldosterone synthesis and secretion
    231991 (Creb5)
   04927 Cortisol synthesis and secretion
    231991 (Creb5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    231991 (Creb5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    231991 (Creb5)
  09156 Nervous system
   04725 Cholinergic synapse
    231991 (Creb5)
   04728 Dopaminergic synapse
    231991 (Creb5)
  09149 Aging
   04211 Longevity regulating pathway
    231991 (Creb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    231991 (Creb5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    231991 (Creb5)
  09162 Cancer: specific types
   05215 Prostate cancer
    231991 (Creb5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    231991 (Creb5)
   05020 Prion disease
    231991 (Creb5)
  09165 Substance dependence
   05030 Cocaine addiction
    231991 (Creb5)
   05031 Amphetamine addiction
    231991 (Creb5)
   05034 Alcoholism
    231991 (Creb5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    231991 (Creb5)
   04934 Cushing syndrome
    231991 (Creb5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    231991 (Creb5)
   05161 Hepatitis B
    231991 (Creb5)
   05163 Human cytomegalovirus infection
    231991 (Creb5)
   05165 Human papillomavirus infection
    231991 (Creb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    231991 (Creb5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    231991 (Creb5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 Cnn_1N DivIC
Other DBs
NCBI-GeneID: 231991
NCBI-ProteinID: NP_766316
MGI: 2443973
Ensembl: ENSMUSG00000053007
Vega: OTTMUSG00000057134
UniProt: Q8K1L0 A0A0N4SUK5
LinkDB
Position
6 B3; 6 25.9 cM
AA seq 357 aa
MSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGM
QGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPH
HHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSP
HPPLPTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATR
CRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQ
GYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtccatgaggcctgtcccaggctctctatcatctctactccatctccacaacagacag
aggcagcccatgccggcctccatgcctggaaccctgcccaaccccaccatgccaggatct
tctgccgtcttgatgcctatggagagacagatgtcagtgaactccagcatcatgggcatg
caaggtccaaacctcagcaacccctgtgcttctccccaagtccagccaatgcattcagaa
gccaaaatgagactgaaggctgcgctgactcaccatcctgccgccatgtcgaacgggaac
atgagcaccatcggacacatgatggagatgatgggctcccggcaagaccagacaccgcac
caccacctgcactcacacccgcatcagcaccagacactgccgccccaccacccctaccca
caccagcaccagcaccccgcacaccatccccacccacagcctcaccaccagcagaaccac
ccgcaccaccactcccattcccaccttcacgcacacccggcgcaccaccagacctcgcca
cacccacccctgcccaccggcaaccaagcacaggtttcaccagctacacaacagatgcag
ccaacccagacaatacaaccgccccagcccacagggggacgccggcgaagagtggtggat
gaggacccagatgagaggcggaggaaatttctggaaaggaaccgggccgccgccacccgc
tgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagctgaagagctcacc
cagacaaacatgcagcttcagaatgaagtgtccatgttgaaaaacgaggtggcccagctg
aagcagttgttgttaacacataaagactgtccgataacagccatgcagaaagaatcccaa
gggtatttaagtccagagagcagccctcctgcgagccctgtgccagcatgctctcagcag
caagttatccaacacaacaccatcactacatcctcatcggtcagcgaggtcgtggggagc
tccaccctcagtcagcttacaactcacagaacagacctgaatcctattctttaa

KEGG   Mus musculus (mouse): 26427
Entry
26427             CDS       T01002                                 

Gene name
Creb3l1, Oasis
Definition
(RefSeq) cAMP responsive element binding protein 3-like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    26427 (Creb3l1)
   04024 cAMP signaling pathway
    26427 (Creb3l1)
   04022 cGMP-PKG signaling pathway
    26427 (Creb3l1)
   04151 PI3K-Akt signaling pathway
    26427 (Creb3l1)
   04152 AMPK signaling pathway
    26427 (Creb3l1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    26427 (Creb3l1)
   04922 Glucagon signaling pathway
    26427 (Creb3l1)
   04915 Estrogen signaling pathway
    26427 (Creb3l1)
   04926 Relaxin signaling pathway
    26427 (Creb3l1)
   04935 Growth hormone synthesis, secretion and action
    26427 (Creb3l1)
   04918 Thyroid hormone synthesis
    26427 (Creb3l1)
   04928 Parathyroid hormone synthesis, secretion and action
    26427 (Creb3l1)
   04916 Melanogenesis
    26427 (Creb3l1)
   04925 Aldosterone synthesis and secretion
    26427 (Creb3l1)
   04927 Cortisol synthesis and secretion
    26427 (Creb3l1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    26427 (Creb3l1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    26427 (Creb3l1)
  09156 Nervous system
   04725 Cholinergic synapse
    26427 (Creb3l1)
   04728 Dopaminergic synapse
    26427 (Creb3l1)
  09149 Aging
   04211 Longevity regulating pathway
    26427 (Creb3l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    26427 (Creb3l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    26427 (Creb3l1)
  09162 Cancer: specific types
   05215 Prostate cancer
    26427 (Creb3l1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    26427 (Creb3l1)
   05020 Prion disease
    26427 (Creb3l1)
  09165 Substance dependence
   05030 Cocaine addiction
    26427 (Creb3l1)
   05031 Amphetamine addiction
    26427 (Creb3l1)
   05034 Alcoholism
    26427 (Creb3l1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    26427 (Creb3l1)
   04934 Cushing syndrome
    26427 (Creb3l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26427 (Creb3l1)
   05161 Hepatitis B
    26427 (Creb3l1)
   05163 Human cytomegalovirus infection
    26427 (Creb3l1)
   05165 Human papillomavirus infection
    26427 (Creb3l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    26427 (Creb3l1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    26427 (Creb3l1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 Jnk-SapK_ap_N DUF4337 TPR_MLP1_2 ELP6 APG6_N ADIP HAUS-augmin3 JMY DUF724 JIP_LZII
Other DBs
NCBI-GeneID: 26427
NCBI-ProteinID: NP_036087
MGI: 1347062
Ensembl: ENSMUSG00000027230
Vega: OTTMUSG00000014377
UniProt: Q9Z125 A0A0R4J082
LinkDB
Position
2; 2 E1
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFVENMEDFSNDLFSSFFD
DPVLDEKSALLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPVKMEDTTQDVEHGAWALG
NKLCSIMVKQEQSPELPVDPLAASSAMAAAAAMATPPLLGLSPMPRLPIPHQAPGEMTQL
PVIKAEPPEMSQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPAFSSGSMTVKEDPIAADSVYAASQM
PSRSLLFYDDGAGSWEDGRGALLPVEPPEGWELKPGGPAEQRPQDHLRHDRADSIHETTK
YLRETWPEDTDDNGTSPNFSHPKEWFHDRDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaacctttcccggccgacaggctgttcccgggatccagcttcctg
gacttgggagacctgaatgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgtggagaacatggaggacttctccaatgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagtgctctgctggacatggaactggactcccccgctcca
ggcatccaggctgagcacagctactccctgagtggggattctgcaccccagagccccctt
gtgcctgtcaagatggaggacaccactcaagatgtggaacacggagcgtgggccctggga
aacaagctgtgctccatcatggtgaagcaggagcagagcccggagctgcctgtagatccc
ctggctgcctcctctgccatggctgctgccgccgccatggccaccccaccactgctgggc
ctcagccccatgccccggctgcccatccctcaccaggccccaggagaaatgactcagctg
ccagtgatcaaagcagagcccccagaaatgagccagtttctcaaagtgacaccagaggac
ctcgtacagatgcctccaacaccccccagcagccatggcagtgacagtgacggctcccag
agtccccgctctcttcccccctccagccctgtccggcccatggcccgctcctccacggcc
atttccacctctccgctcctcactgcccctcacaaactgcaggggacatcagggccactg
ctcttgacagaagaggagaagcggaccttgatcgcggagggttaccctatccccaccaag
ctccccctcaccaaggctgaggagaaggccttgaagagagtacgcaggaaaattaagaac
aagatttctgcccaggagagccgccgcaagaagaaggagtatgtggaatgtctagaaaag
aaggtggagacatatacatcagagaacaatgagctgtggaagaaagtggaaaccctagag
actgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccagcaag
atctccagaccgtacaagatggcagccacgcagaccggcacctgcctcatggtggcagcc
ttgtgcttcgttctggtgctgggctcccttgtgccctgccttcctgcattctcttccggc
tcaatgactgtgaaagaagaccctatcgcagctgacagtgtctatgcagccagtcagatg
ccttcccgaagcctactgttctacgatgatggggcaggctcatgggaagatggccgaggt
gctctactgcctgtggagcccccagaaggctgggagctcaaacccgggggtccagcagag
cagaggccccaggaccacctccgacatgaccgtgcagacagcatccatgagaccaccaag
tacttgagagagacctggccagaggacactgatgacaacggcaccagccccaacttctcc
caccccaaggagtggttccatgacagggatctgggccccaacaccaccatcaaactctcc
tag

KEGG   Mus musculus (mouse): 78284
Entry
78284             CDS       T01002                                 

Gene name
Creb3l4, 1700012K17Rik, 5330432F22Rik, AIBZIP, ATCE, AV040530, AV258827, CREB4, J, JAL, TISP40, Tis, Tisp, acre1, mJ
Definition
(RefSeq) cAMP responsive element binding protein 3-like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    78284 (Creb3l4)
   04024 cAMP signaling pathway
    78284 (Creb3l4)
   04022 cGMP-PKG signaling pathway
    78284 (Creb3l4)
   04151 PI3K-Akt signaling pathway
    78284 (Creb3l4)
   04152 AMPK signaling pathway
    78284 (Creb3l4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    78284 (Creb3l4)
   04922 Glucagon signaling pathway
    78284 (Creb3l4)
   04915 Estrogen signaling pathway
    78284 (Creb3l4)
   04926 Relaxin signaling pathway
    78284 (Creb3l4)
   04935 Growth hormone synthesis, secretion and action
    78284 (Creb3l4)
   04918 Thyroid hormone synthesis
    78284 (Creb3l4)
   04928 Parathyroid hormone synthesis, secretion and action
    78284 (Creb3l4)
   04916 Melanogenesis
    78284 (Creb3l4)
   04925 Aldosterone synthesis and secretion
    78284 (Creb3l4)
   04927 Cortisol synthesis and secretion
    78284 (Creb3l4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    78284 (Creb3l4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    78284 (Creb3l4)
  09156 Nervous system
   04725 Cholinergic synapse
    78284 (Creb3l4)
   04728 Dopaminergic synapse
    78284 (Creb3l4)
  09149 Aging
   04211 Longevity regulating pathway
    78284 (Creb3l4)
  09159 Environmental adaptation
   04714 Thermogenesis
    78284 (Creb3l4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    78284 (Creb3l4)
  09162 Cancer: specific types
   05215 Prostate cancer
    78284 (Creb3l4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    78284 (Creb3l4)
   05020 Prion disease
    78284 (Creb3l4)
  09165 Substance dependence
   05030 Cocaine addiction
    78284 (Creb3l4)
   05031 Amphetamine addiction
    78284 (Creb3l4)
   05034 Alcoholism
    78284 (Creb3l4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    78284 (Creb3l4)
   04934 Cushing syndrome
    78284 (Creb3l4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    78284 (Creb3l4)
   05161 Hepatitis B
    78284 (Creb3l4)
   05163 Human cytomegalovirus infection
    78284 (Creb3l4)
   05165 Human papillomavirus infection
    78284 (Creb3l4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    78284 (Creb3l4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    78284 (Creb3l4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB EMP24_GP25L ATG16 CASP_C KASH_CCD DUF4407 UPF0242 SOGA DUF2207 TMCO5 Jnk-SapK_ap_N Spc7 DUF724
Other DBs
NCBI-GeneID: 78284
NCBI-ProteinID: NP_001294863
MGI: 1916603
Ensembl: ENSMUSG00000027938
Vega: OTTMUSG00000021959
UniProt: Q9D2A5
LinkDB
Position
3; 3 F1
AA seq 370 aa
MELGCPELLEPPEDIFSTGSFLELGFNGPASKVPVTRGLQKSEPDDFLNLFIDPNMIHCS
ETSPGRDSGVSEDPGSPAQQASSSPALYEVVYDSGTLQGTQREAGPTFGLISIQIDQWTP
ALMVPDACTVSGLPSDSHRHILPRVSTRAPAPPAAMPSCQHHLFLTDEEKQLLAQEGITL
PSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQ
ELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSFSPFQGQSEARP
EDYQLHGVISRNILTHENVTENLESPVLKSKLEELPEAPTTNGSTKTHLKMRVKARPPGQ
IRGMVHTDEM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggagctcgggtgccctgagttgctggaacccccagaagatatcttctcgacgggatcc
ttcctggagctgggattcaacggtcccgcgtcaaaggtcccggtgaccaggggccttcag
aagagtgaacctgacgatttcctgaacctctttatcgatcccaatatgatacactgctca
gaaacatctcctggtagggacagtggggtctctgaagatcctggctcccctgcccaacag
gcttccagttcccctgccctctatgaggttgtctatgattcagggaccctacagggaact
cagcgggaagctgggccaaccttcggactcatctctattcagatagatcagtggacccct
gcacttatggtccctgatgcatgcacagtcagtggactgccctccgattcgcatagacat
atcctgcctagggtcagcaccagagccccagcacctcctgcagccatgccgtcctgccaa
catcatctgttcctgacagatgaagaaaagcaactgctggcacaagaagggattactctg
ccctctcacctgcccctcaccaaggcagaggagagaatactcaagaagatcaggaggaaa
atccgcaacaagcagtcggctcaggacagccggcggcggaagaaagaatacttagatggg
ctggagagcagagtggcggcctgttcggaacagaatcagaaactacagagaaaggtccag
gagctggagaggcagaacatcttcttgatggaacaggtccgccagttacagaagctcact
gctcagacctccagcagagctgcccagaccagcacctgtgttctgattcttcttttttca
ctggctctcatcatcctgcccagtttcagcccctttcagggtcaatcagaagctaggccc
gaggattatcagcttcatggagtgatttccagaaatatcttgactcacgagaacgtaaca
gaaaacctggagagtccagtgctaaagtccaaactggaggagctacctgaagccccaact
acaaatggttcaacaaagacacatctgaagatgcgagtgaaggcgagaccccctggacag
atcaggggaatggtgcatacagatgagatgtaa

DBGET integrated database retrieval system