KEGG   Mus musculus (mouse): 11920Help
Entry
11920             CDS       T01002                                 

Gene name
Atm, AI256621, C030026E19Rik
Definition
(RefSeq) ataxia telangiectasia mutated
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03440  Homologous recombination
mmu04064  NF-kappa B signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    11920 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11920 (Atm)
   04068 FoxO signaling pathway
    11920 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    11920 (Atm)
   04210 Apoptosis
    11920 (Atm)
   04115 p53 signaling pathway
    11920 (Atm)
   04218 Cellular senescence
    11920 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    11920 (Atm)
   05206 MicroRNAs in cancer
    11920 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11920 (Atm)
   05170 Human immunodeficiency virus 1 infection
    11920 (Atm)
   05165 Human papillomavirus infection
    11920 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11920 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11920 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11920 (Atm)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11920 (Atm)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11920 (Atm)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   11920 (Atm)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     11920 (Atm)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    11920 (Atm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC RYDR_ITPR
Motif
Other DBs
NCBI-GeneID: 11920
NCBI-ProteinID: NP_031525
MGI: 107202
Ensembl: ENSMUSG00000034218
Vega: OTTMUSG00000031707
UniProt: Q62388 B9EHX4
LinkDB All DBs
Position
9 A5.3; 9 29.12 cM
AA seq 3063 aa AA seqDB search
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKEMESLRTAKSNVSATTQSSRQKKMQEISSLVRYFIKCANKRAPRLKCQDL
LNYVMDTVKDSSNGLTYGADCSNILLKDILSVRKYWCEVSQQQWLELFSLYFRLYLKPSQ
DINRVLVARIIHAVTRGCCSQTDGLPSKFLDLFSKAIQYARQEKSSPGLSHILAALNIFL
KSLAVNFRKRVCEAGDEILPTLLYIWTQHRLNDSLKEVIIELIQLQIYIHHPQGARAPEE
GAYESMKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADICYQLFDAD
TRSVEISQSYVTQRESTDYSVPCKRRKIDVGWEVIKDYLQKSQSDFDLVPWLQITTRLIS
KYPSSLPNCELSPLILILYQLLPQQRRGERIPYVLRCLKEVALCQGKKSNLESSQKSDLL
KLWIKIWSITFRGISSGQTQTENFGLLEAIIQGSLVELDREFWKLFTGSACKPSSPSVCC
LTLALSICVVPDAIKMGTEQSVCEANRSFSVKESIMRWLLFYQLEDDLEDSTELPPILQS
NFPHLVVEKILVSLTMKNSKAAMKFFQSVPECEQHCEDKEEPSFSEVEELFLQTTFDKMD
FLTTVKEYAVEKFQSSVGFSVQQNLKESLDHYLLGLSEQLLSNYSSEITSSETLVRCSSL
LVGVLGCYCYMGIITEDEAHKSELFQKAKSLMQCAGESISLFKNKTNEESRIGSLRNVMH
LCTSCLCIHTKHTPNKIASGFFLRLLTSKLMNDIADICKSLASCTKKPLDHGVHPGEDDE
DGGGCDSLMEAEGPSSTGLSTAYPASSVSDANDYGENQNAVGAMSPLAADYLSKQDHLLL
DMLRFLGRSVTASQSHTVSFRGADIRRKLLLLLDSSILDLMKPLHLHMYLVLLKDLPGNE
HSLPMEDVVELLQPLSLVCSLHRRDQDVCKTILSNVLHIVTNLGQGSVDMESTRIAQGHF
LTVMGAFWHLTKEKKCVFSVRMALVKCLQTLLEADPYSEWAILNVKGQDFPVNEAFSQFL
ADDHHQVRMLAAGSVNRLFQDMRQGDFSRSLKALPLKFQQTSFNNAYTTAEAGIRGLLCD
SQNPDLLDEIYNRKSVLLMMIAVVLHCSPVCEKQALFALCKSVKENRLEPHLVKKVLEKV
SESFGCRSLEDFMISHLDYLVLEWLNLQDTEYSLSSFPFMLLNYTSIEDFYRSCYKILIP
HLVIRSHFDEVKSIANQIQKCWKSLLVDCFPKILVHILPYFAYEGTRDSYVSQKRETATK
VYDTLKGEDFLGKQIDQVFISNLPEIVVELLMTLHETADSADSDASQSATALCDFSGDLD
PAPNPPYFPSHVIQATFAYISNCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNVF
KKHRILKIYHLFVSLLLKDIQSGLGGAWAFVLRDVIYTLIHYINKRSSHFTDVSLRSFSL
CCDLLSRVCHTAVTQCKDALESHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNKDNKN
LSVTIKLLDPFPDHVIFKDLRLTQQKIKYSGGPFSLLEEINHFLSVSAYNPLPLTRLEGL
KDLRRQLEQHKDQMLDLLRASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGRC
LGEIGPLDFSTIAVQHNKDVSYTKAYGLPEDRELQWTLIMLTALNNTLVEDSVKIRSAAA
TCLKNILATKIGHIFWENYKTSADPMLTYLQPFRTSRKKFLEVPRSVKEDVLEGLDAVNL
WVPQSESHDIWIKTLTCAFLDSGGINSEILQLLKPMCEVKTDFCQMLLPYLIHDVLLQDT
HESWRTLLSAHVRGFFTSCFKHSSQASRSATPANSDSESENFLRCCLDKKSQRTMLAVVD
YLRRQKRPSSGTAFDDAFWLDLNYLEVAKVAQSCSAHFTALLYAEIYSDKKSTDEQEKRS
PTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRIR
TYEHEATWEKALVTYDLETSISSSTRQSGIIQALQNLGLSHILSVYLKGLDYERREWCAE
LQELRYQAAWRNMQWGLCASAGQEVEGTSYHESLYNALQCLRNREFSTFYESLRYARVKE
VEELSKGSLESVYSLYPTLSRLQAIGELENSGELFSRSVTDRERSEAYWKWQKHSQLLKD
SDFSFQEPLMALRTVILETLVQKEMERSQGACSKDILTKHLVEFSVLARTFKNTQLPERA
IFKIKQYNSAICGISEWHLEEAQVFWAKKEQSLALSILKQMIKKLDSSFKDKENDAGLKV
IYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARF
SDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALR
ALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISS
YKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLS
KPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANM
DASQWRAQRKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEYENLVTIKSFKTEFRLA
GGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTIC
TYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSF
EEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHV
QNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEK
TMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQECKQ
SLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWK
AWV
NT seq 9192 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcactcaatgatctgctcatttgctgccggcagttagagcatgacagagct
acagaaagaaggaaagaagtggataaatttaagcgcctgattcaggatcctgaaacagtt
caacatttagataggcattctgattccaaacaaggaaaatatctgaattgggatgctgtt
ttcaggtttttacagaagtacattcaaaaagaaatggaaagtctgagaacagcaaaatca
aatgtatcagccaccacacagagctccagacagaagaagatgcaagagatcagcagtttg
gtcagatacttcatcaaatgtgcaaacaaaagagcacccaggctaaaatgtcaagacctc
ttgaattatgtcatggatacagtgaaagactcatctaatggtctaacgtatggagctgac
tgtagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaagtatct
cagcaacagtggctagaattgttttcactgtacttcaggctgtatctcaagccatcacag
gacattaatagagttttagtggctagaataattcatgctgtcaccagaggatgctgttca
cagactgatggattaccttcaaagtttttagatcttttttccaaggctattcagtatgcc
agacaagaaaagagctctcctggcttaagtcacatcttagcagcccttaacattttcctc
aagtctctggctgtcaacttccgaaaacgggtgtgtgaagcaggagatgaaattcttcct
accttactatatatttggactcaacatagacttaatgattctttaaaagaagtaattatt
gaactaattcaactgcagatttatatccatcatccacaaggagccagagctcctgaagaa
ggtgcttatgaatccatgaaatggaaaagtatcttgtacaacttatatgacttgctagtg
aatgagataagtcatataggaagccgagggaaatattcctcaggatctcgtaatattgct
gtcaaggaaaatctgattgacctgatggcagatatctgttaccagctttttgatgcagat
accagatccgtggagatttctcaatcttatgtgacacaaagggaatccactgattacagt
gtaccttgcaaaagaaggaaaatagacgtaggctgggaagtgataaaagattatcttcag
aagtcacagagtgattttgatctcgtgccttggctacagattacaacccgattaatatca
aaatatccttccagtttacctaactgtgagctgtctccattaatactgatactgtaccag
cttctgcctcaacagcgacgtggagaacgcatcccatatgtgttacgatgccttaaggaa
gttgccttatgtcaaggcaagaaatcaaacctggaaagctctcagaagtcagatttattg
aaactatggatcaaaatttggtctattacctttcgtggtataagttctggacaaacacaa
actgaaaactttggtttacttgaggccatcattcaaggtagtttagttgaacttgacaga
gaattctggaagttatttactggctcagcctgtaaaccttctagtccttcagtatgctgc
ttgactttggcacttagcatctgtgtagttccagatgcaataaaaatgggaacagaacaa
agtgtgtgtgaagcaaatagaagtttttctgtaaaggagtcaataatgaggtggctctta
ttctaccagttagaggatgacttagaagacagcacagagctgcctccaattcttcagagt
aattttcctcatcttgtagtcgaaaaaattcttgtaagtctcactatgaaaaactcaaaa
gctgcaatgaagttttttcaaagtgtgccagaatgtgaacaacactgcgaagataaagaa
gagccttcattttcagaagtagaagaactgtttcttcagactacttttgacaagatggat
tttttaactactgtcaaagagtatgctgtagaaaaatttcagtctagtgttggcttctct
gtccagcaaaatctcaaggaatcattggatcactatcttctgggattatcagaacagctt
ttaagtaattactcttctgagattacaagttctgaaacccttgtccggtgttcaagtctt
ttggtgggtgttcttggctgctattgttacatgggtataataactgaagacgaagcccat
aaatcagaattattccagaaagccaagtctctgatgcaatgtgcaggagaaagtatctct
ctgtttaaaaataaaacaaatgaggaatcaagaattggttcattgagaaatgtgatgcat
ctgtgtacaagttgcttgtgtatacataccaagcatacgccaaacaagattgcctctggc
tttttcctacgattattaacatcaaagcttatgaatgacattgcagatatttgtaaaagt
ttagcatcctgtacgaaaaagccattggatcacggagtacatccaggggaagatgatgaa
gatggtggtggttgtgacagtctgatggaggcagagggtccatcgtccactggtctttct
actgcttaccccgctagttctgtgagcgatgcaaatgattatggagagaaccagaatgct
gttggtgccatgagtcctttagctgccgactacctgtccaaacaagatcatcttctctta
gacatgctcaggttcttaggccgatctgtaactgcatctcagagccatactgtgtcgttt
agaggagctgacattagaagaaaattgttactgttgcttgattctagcatactcgatctc
atgaagcccctccacctgcatatgtacttagtgctcctgaaggatctccctggaaacgag
cactcattgccaatggaagatgttgttgaacttctgcaaccattatcccttgtgtgttct
ctgcaccgacgtgaccaagatgtctgtaaaacgattctaagcaatgtccttcatatagtg
acaaacctaggccagggcagtgtggacatggagagcacacggattgctcaaggacacttc
ctgacagtgatgggagcattttggcatttgacaaaggaaaagaaatgtgtattctctgta
agaatggcattagtaaagtgtcttcaaacattgcttgaggctgatccatattccgaatgg
gcaattcttaatgtaaaaggacaagactttcctgtaaatgaagctttttcacaatttctt
gctgacgatcatcatcaagttcggatgttggctgcagggtcagtcaacagattatttcag
gatatgagacaaggcgatttctccagaagcttgaaagcactccctctgaagtttcagcag
acatcttttaacaatgcatacacgacagcagaggcggggatcagaggactgttatgtgat
tctcagaaccctgatctgctggatgagatctataacagaaaatctgtactactgatgatg
atagctgtggtcttgcactgtagcccagtctgtgaaaagcaggctttgtttgctttatgc
aagtctgtgaaggaaaacagactagaacctcatcttgtgaaaaaggttttagagaaagtc
tccgaatcgtttggatgtagaagtttagaagacttcatgatttctcacctagactacctg
gttttggaatggctgaaccttcaagatactgaatatagcttatcttcttttccttttatg
ttattaaactacacaagcattgaggatttctatcggtcttgttacaagattttgatccca
catttggtaatcagaagccattttgatgaggtgaagtccattgctaatcagattcaaaag
tgctggaaaagcctgttggtagattgctttccgaagattcttgtgcacatccttccttac
tttgcctacgagggcacgagagacagctacgtgtcacagaaaagagagactgctaccaag
gtctacgatactcttaaaggggaagacttcctaggaaaacagattgaccaagtattcatt
agtaatttgccagagattgtggtggagttgctgatgacattgcatgagacagctgactcg
gctgactcggacgccagtcaaagcgccaccgccttgtgtgatttttcaggggatttggat
cctgcccccaacccgccatatttcccctcacatgtcattcaggcaacgtttgcttacatc
agcaactgtcataaaaccaagtttaaaagcattctagaaattctttctaaaatccccgat
tcctatcagaaaatacttctggccatttgtgaacaagcagctgagacaaataatgtcttt
aaaaagcacagaattcttaaaatatatcacctgtttgttagtttattactgaaagatata
cagagtggcctgggaggggcttgggcctttgtccttcgcgatgttatttatactctgatt
cactacatcaacaaaaggtcttctcatttcacagatgtgtcgttgcgtagcttttccctt
tgctgtgacctattaagtcgagtttgtcatacagctgtaactcaatgtaaggatgctcta
gaaagccatcttcacgttatcgttggcacacttattccccttgtggattatcaggaagtt
caagaacaggtattggacctgttgaagtacttagtgatagataacaaagacaataaaaac
ctctctgtcacaattaagcttttggatccctttcctgaccatgttatttttaaggacttg
cgtcttactcaacagaaaatcaaatatagtggaggacctttttcactcttagaggaaata
aaccattttctctcagtaagtgcttacaatccacttccgctgaccaggcttgaaggactg
aaggatcttcgaagacaactggagcaacataaagatcagatgctagatcttctgagagcg
tctcaagataacccacaagatggcattgtggtgaagctagttgtcagcttgttgcagtta
tccaagatggcagtgaaccagactggtgaaagagaagttttagaggctgtcggaaggtgt
ttgggagaaataggtcctctggatttctccaccatagctgtccagcataacaaagatgtg
tcctataccaaagcctacgggttacctgaagacagagaacttcagtggaccttgataatg
ctgactgccctcaacaataccctggtagaggacagtgtcaaaattcgatctgctgctgct
acctgtttgaaaaacattttggctacaaagattggacatattttctgggagaattataag
acatcagcggatccaatgctgacctatctacaaccttttagaacatcgaggaaaaagttt
ttagaagtgccccgatctgttaaagaagatgttttagaaggcctggatgctgtgaatctg
tgggttcctcaaagtgaaagtcatgacatttggataaagacactgacgtgtgcctttctg
gacagtggaggcataaacagtgaaattctccagttattaaagccaatgtgtgaagtgaaa
accgacttctgtcagatgttgctgccatacttgatccatgatgttttactgcaagataca
catgaatcgtggagaactctgctgtctgcgcacgtccgaggatttttcactagttgtttt
aagcattcctcccaagcaagccgctcagcaactcctgcaaattcggattcagagtcagag
aactttctccgatgctgtttggataaaaagtcacaaagaaccatgcttgctgttgtcgac
tatctgagaaggcaaaagagaccttcctcgggaacagcttttgatgacgctttctggctg
gatttgaattatcttgaggttgcgaaggtggctcagtcctgctctgctcacttcacggcc
ttgctctacgcagagatctattcagataagaaaagcacagacgagcaagagaaaagaagt
ccaacatttgaagaaggaagtcaaggaacaactatttctagtttgagtgaaaaaagtaaa
gaagaaactggaataagcttacaggatcttctcttagagatctacagaagtataggagag
ccggacagcctgtatggctgtggaggagggaaaatgttacaaccccttactagaatacgg
acatatgaacatgaagctacgtgggagaaagccttagtaacttacgacctggagaccagc
atctcctcctccacccgccagtcaggaatcatccaggccctgcagaatttggggctctcc
catatcctgtctgtctatctgaaaggattagactatgaaagacgagagtggtgcgctgag
ctgcaggagctgcgttaccaggcggcgtggaggaacatgcagtggggcctctgcgcttct
gccggccaagaagtagaaggaaccagttaccatgaatcgttgtataatgctctgcagtgt
ctaagaaacagagaattctccacattttatgaaagtctccgatatgccagggtgaaagaa
gttgaagagttgagtaagggcagccttgagtctgtatattcgctgtatcccacacttagt
agattgcaggcaattggagaactggaaaacagtggcgagcttttctcaaggtcagtcaca
gacagagagcgctctgaagcatactggaagtggcagaagcactcccagcttctgaaagac
agcgacttcagctttcaggagcctctcatggctctgcgcacagtcattctggagaccctg
gtacagaaggaaatggagcgctctcaaggagcatgctctaaggacattctcaccaaacac
ctcgttgaattctctgttctggctcgaaccttcaagaacacacagctccctgaaagagca
atattcaaaattaagcaatataattcagctatttgtggaatttctgagtggcatttggaa
gaagcacaagtattctgggcaaaaaaggagcagagtcttgctctgagtattctcaagcag
atgatcaagaagttggactccagctttaaagataaagagaatgatgcaggtctcaaagtc
atatacgcagagtgtctgagggtttgtggcagctggctggcagaaacttgcttagaaaac
cctgcagtcatcatgcagacctatctagaaaaggcggtgaaggttgctggaagttacgat
ggcaacagcagagagctcagaaatggacagatgaaggcctttctctcgttggcaaggttc
tctgatactcagtaccagagaattgaaaactacatgaagtcatcagaatttgaaaacaag
caaactctcttaaaaagagccaaagaggaagtgggccttctaagggaacataaaattcag
accaacagatacacagtaaaggttcagcgagaactggagctggacgaatgtgctctccgt
gcactgagagaggatcgcaagcgcttcctgtgtaaagcagtggagaactacatcaactgc
ttactaagcggggaagaacatgatctgtgggtgttccggctttgctccctctggcttgaa
aattctggagtttctgaagtcaatggcatgatgaagaaagatggaatgaagatttcatcc
tataagtttttgcctctcatgtatcaattggctgctcgaatggggaccaaaatgacggga
ggcctaggatttcacgaagtcctcaataatctaatctctaggatttcactggatcacccc
catcatactttgttcattatactggccttagcaaatgcgaacaaagatgaatttttgagc
aaaccagagacaacaagaaggagtcgaataaccaaaagtacatctaaagaaaactctcac
cttgatgaggatcgaacagaggctgcaaccagaatcatccactccatcagaagtaagcga
tgtaagatggtgaaggacatggaggcgctctgcgatgcctacatcatcttggcaaacatg
gacgcctctcagtggagggctcagagaaaaggcatcaatattccagccaaccagccaatc
actaaactgaagaatttagaagatgttgttgttcccactatggaaattaaggttgatccc
acaggagagtatgaaaatctggtgactataaaatcatttaaaacagaatttcgcttagct
ggaggcttaaatttacccaaaataatagattgtgtgggttctgatggcaaggaaaggaga
cagcttgtgaagggccgtgatgacctgaggcaagatgctgtcatgcagcaggtcttccag
atgtgcaatacactactgcagagaaacactgagactagaaagaggaaactgactatctgc
acatacaaggtggttcccctttctcagcgaagcggtgttctcgagtggtgcacaggaacc
gttcctattggtgaatatcttgttaacagcgaagacggtgcacatagaagatacaggcca
aatgatttcagtgccaatcagtgccaaaagaaaatgatggaagtgcagaagaagtctttt
gaagagaaatatgataccttcatgacgatttgccaaaactttgaaccagttttccgttac
ttctgcatggaaaaattcttggacccagctgtttggtttgagaaacgattggcatataca
cgcagtgtggccacatcttctatcgtcggttacatccttggacttggcgacaggcacgta
cagaatatcttgataaacgagcagtcggcagagcttgtgcacatagacctgggagtggct
tttgaacaggggaagatccttcccactccagaaacagttccttttagactcagcagagat
attgtggacgggatgggcatcaccggtgtggaaggtgtcttcagaaggtgctgtgaaaaa
acgatggaagttatgcggagttctcaggaaaccctgctgaccattgtagaggttcttttg
tacgatccactctttgattggactatgaatcctttaaaagctctgtatctacagcagaga
ccagaagatgagtccgacctccattccacccccaatgcagatgatcaagaatgcaaacaa
agtcttagtgatactgaccagagtttcaacaaagtagctgagcgtgtcttgatgagactg
caagagaaactgaaaggcgtggaggaaggcactgtgctcagtgtgggtggacaggtgaac
ttgcttatccagcaggccatggatcccaaaaatctcagccgactcttcccaggatggaaa
gcttgggtgtga

DBGET integrated database retrieval system