KEGG   Mus musculus (mouse): 12005Help
Entry
12005             CDS       T01002                                 

Gene name
Axin1, AI316800, Axin, Fu, Kb, Ki, fused, kinky, knobbly
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12005 (Axin1)
   04390 Hippo signaling pathway
    12005 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12005 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12005 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12005 (Axin1)
   05225 Hepatocellular carcinoma
    12005 (Axin1)
   05226 Gastric cancer
    12005 (Axin1)
   05217 Basal cell carcinoma
    12005 (Axin1)
   05213 Endometrial cancer
    12005 (Axin1)
   05224 Breast cancer
    12005 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12005 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12005 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12005 (Axin1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12005 (Axin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Motif
Other DBs
NCBI-GeneID: 12005
NCBI-ProteinID: NP_033863
MGI: 1096327
Ensembl: ENSMUSG00000024182
Vega: OTTMUSG00000026498
UniProt: O35625 E9QMJ8
LinkDB All DBs
Structure
PDB: 

Position
17 A3.3; 17 13.07 cM
AA seq 868 aa AA seqDB search
MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSE
TSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLL
DFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQ
QIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMS
GYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYG
SWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRRE
MQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKR
VRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQ
RVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHH
HVHHNSARPKEQMEAEVARRVQSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTS
APSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQ
QAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRL
EEEEKRANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGG
GSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCG
VVFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtcccaaaatgaatgtccaggagcagggtttccccttggacctcggagcaagt
ttcaccgaagatgccccccggcccccagtgcctggagaagagggagaactggtatctact
gattcgaggcctgtcaaccacagtttctgttctgggaaaggtaccagcattaaaagtgag
acctcaacagccaccccaagacgttcagatctggatctgggatatgagcccgagggcagt
gcctcccccaccccaccatatttgaggtgggctgagtcactgcattccttactggatgac
caagatgggatcagcctgttcaggactttcctgaagcaggagggctgtgctgacctgctg
gacttctggtttgcctgcagtggcttcaggaagcttgagccctgtgactcaaatgaggaa
aagaggctgaagctggcaagagccatctaccgaaagtacatcctggatagcaatggcatt
gtgtccagacaaaccaagccagccactaagagcttcataaaggactgtgtcatgaagcag
cagatagatcctgccatgtttgaccaggcacagacagaaatccagtccaccatggaggag
aatacctacccttcctttcttaagtctgacatttatttggagtacacaaggacaggctca
gagagtccgaaggtctgcagtgaccagagctcagggtctggaacagggaagggcatgtct
ggatacctgcccactttgaatgaggatgaagaatggaaatgtgaccaagatgcagatgag
gatgatggccgagaccctctcccccccagcaggctcacccagaagctgctattggagact
gctgccccgagggccccctcaagtagacggtacaacgaaggcagagagctcaggtatgga
tcttggagggagcccgtcaacccctactacgtcaactctggctatgccctggccccagcc
accagtgccaatgacagtgagcagcagagcctgtccagtgatgctgacacgctatccctt
acggacagtagtgtggatggaatccccccatacaggatccgtaagcagcaccgaagggag
atgcaggagagtatccaagtcaatgggcgggtacctctacctcacattcctcgcacttac
cgaatgccaaaggagatccgggtagagccacagaaatttgctgaagagcttattcaccgt
ctagaggctgtccagcgcactcgagaggctgaagaaaagttggaggaacggctgaagcgt
gtacgcatggaggaagaaggggaggatggtgaaatgccttctggccccatggcaagtcac
aagctgccttctgtcccagcttggcaccatttcccaccccgctatgtggatatgggctgc
tctggactgcgggatgcccatgaggagaatcctgagagcatcctggatgagcacgtgcaa
agggtcatgaggacacctggctgccagtcacctggcccaggccaccgctctcctgacagt
gggcatgtggctaagactgcagtgctagggggtacagcctccgggcatgggaagcatgtt
cctaagttagggttgaagctggatacagctggcctgcaccatcatagacatgtccaccac
catgttcaccataattcagctagacctaaggagcaaatggaggctgaagttgcccgcagg
gtccagagcagcttctcgtggggcccagaaacacatggtcatgccaagccccggagctat
tccgagaacgcaggcaccaccctcagtgctggggatttggcctttggtggtaaaactagt
gcaccttccaaaagaaacaccaagaaggctgaatctgggaagaatgccaatgctgaggta
cccagtaccacagaggacgctgagaagaaccagaagatcatgcagtggatcattgaggga
gagaaggagatcagtagacaccggaaggcaggccatgggtcttctgggttgaggaagcag
caggcccatgaaagctccaggcccttgtccatcgagcgtcctggggccgtgcacccctgg
gtcagcgctcagcttcggaattctgtccagccttctcatcttttcatccaagatcccaca
atgccacccaatccagcccctaatcccctgacccagctggaagaggcccgcaggcgtttg
gaagaagaagaaaagagagcaaacaaactgccctccaagcagaggtatgtgcaggcagtc
atgcagcggggacgcacctgtgtcaggccagcttgtgcaccggtgctgagtgtggtacca
gccgtgtcggacttggaactctccgagacagagacaaaatcacaaagaaaggcaggtggc
gggagtgcaccaccatgtgacagcattgttgtggcctactatttctgtggggaacccatc
ccctaccggaccctggtgaggggccgtgctgtcaccctgggccagttcaaggagctgcta
accaagaaggggagctacagatactactttaagaaagtgagtgatgagtttgactgtggt
gtggtatttgaggaagtacgggaggatgaggccgtcttgcctgtctttgaagaaaagatc
atcggcaaggtggaaaaggtggactga

KEGG   Mus musculus (mouse): 12006Help
Entry
12006             CDS       T01002                                 

Gene name
Axin2, Axi1, Axil, Conductin
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12006 (Axin2)
   04390 Hippo signaling pathway
    12006 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12006 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12006 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12006 (Axin2)
   05225 Hepatocellular carcinoma
    12006 (Axin2)
   05226 Gastric cancer
    12006 (Axin2)
   05217 Basal cell carcinoma
    12006 (Axin2)
   05213 Endometrial cancer
    12006 (Axin2)
   05224 Breast cancer
    12006 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12006 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12006 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12006 (Axin2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12006 (Axin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind SdrD_B
Motif
Other DBs
NCBI-GeneID: 12006
NCBI-ProteinID: NP_056547
MGI: 1270862
Ensembl: ENSMUSG00000000142
Vega: OTTMUSG00000003199
UniProt: O88566 Q3UQK5
LinkDB All DBs
Position
11 E1; 11 71.83 cM
AA seq 840 aa AA seqDB search
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGVPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQQCH
TLLPTGGKLPPVAACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCL
CPGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTLPKRNAKGTEPGLALSARDGGMSSA
AGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESACAAPGERVSRHHL
LGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRD
RNHSAAGQAGASPFANPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKA
QSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgccgtgttagtgactctccttccagatcccagcagcagcttccgcgaggat
gctccgcggcccccggttccgggagaagaaggggagaccccaccgtgtcagcctagtgtg
ggcaaggtccagtccaccaaacctatgcccgtttcctctaatgctaggcggaatgaagat
ggactgggggagcccgaggggcgggcctcccccgattcccctttgaccaggtggaccaag
tctttacactccttgttgggtgaccaggatggtgcatacctcttccggactttcctggag
agggagaaatgtgtggatacgctggacttctggtttgcttgtaatgggttcaggcagatg
aacctgaaggataccaaaactttgcgagtggccaaagcaatctataagaggtacattgag
aacaacagcgttgtctccaagcagctgaagcccgccaccaagacctacatacgagatggc
atcaagaagcaacagatcggctcggtcatgtttgaccaggcacagaccgagatccaggca
gtgatggaggaaaatgcctaccaggtgttcttgacttctgacatttacctggaatatgtg
aggagtgggggggaaaacacagcttacatgagtaacgggggactggggagcctaaaggtc
ttatgtggctacctccccaccttgaatgaagaagaggagtggacgtgtgccgacctcaag
tgcaaactctcacccaccgtggttggcttgtccagcaaaactcttcgggccaccgcgagt
gtgagatccacggaaacagctgaaaacggattcaggtccttcaagagaagcgacccagtc
aatccttatcacgtaggttccggctatgtctttgcaccagccaccagcgccaacgacagc
gagttatccagcgacgcactgaccgacgattccatgtccatgacggacagtagcgtagat
ggagtccctccttaccgcatggggagtaagaaacagctccagagagagatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacgcctgtggaacctgctgccttcgccgccgagctcatctccaggctggagaaa
ctgaaactggagctggaaagccgccatagtctggaggagcggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggtccag
caccccctggccctcctaccctccggcagctatgaagaggacccacaaaccattttggac
gaccacctctccagggtcctcaagacccccggctgtcaatcccctggtgtgggtcgctat
agcccacggtcccgctcccccgaccaccaccaccagcaccaccaccatcagcagtgtcat
acccttcttccgactgggggcaagctgccccccgtggctgcttgccccctccttggaggc
aagagcttcctgaccaaacagacgacgaagcacgttcaccaccactacatccaccaccac
gctgtccccaagaccaaggaggagatcgaggcagaagccacacagagagtccgctgcctc
tgtcctgggggaacagattattattgctactccaaatgcaaaagccacccaaaggctcca
gagcccctgcctggggagcagttttgtggcagcagaggtggtaccttgccaaaacggaat
gcaaagggcaccgaaccgggtcttgcactgtcggccagggatggagggatgtccagtgca
gcgggggccccccagcttcctggggaagaaggagaccggtcacaggatgtctggcagtgg
atgttagagagtgagcggcagagcaagtccaagccccatagtgcccaaagcataagaaag
agctacccattggagtctgcctgtgcggccccaggagaacgagtcagccggcaccatctg
ttgggggccagcggacactcccgctcggtggcccgggctcacccatttacccaggaccct
gcaatgcctccccttaccccacccaacactttggcacagctagaggaagcctgccgcagg
ctggcagaggtgtcgaagccccagaagcagcggtgctgcgtggccagtcagcagagggac
aggaaccactcggctgctggtcaggcaggagcctcacccttcgccaacccaagcctggct
ccagaagatcacaaagagccaaagaaactggcaagtgtccacgcgctccaggccagtgag
ctggttgtcacctactttttctgtggagaagaaattccatacaggaggatgctgaaggct
caaagcttgaccctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtat
tatttcaagaaggcgagtgacgaatttgcctgcggagcagtttttgaggagatctgggac
gacgagacagtgctccccatgtacgaaggcaggatcctgggcaaagtggagaggatcgac
tga

DBGET integrated database retrieval system